KEGG   Homo sapiens (human): 4891
Entry
4891              CDS       T01001                                 
Symbol
SLC11A2, AHMIO1, DCT1, DMT1, NRAMP2
Name
(RefSeq) solute carrier family 11 member 2
  KO
K21398  natural resistance-associated macrophage protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04216  Ferroptosis
hsa04978  Mineral absorption
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Disease
H01196  Hypochromic microcytic anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    4891 (SLC11A2)
  09143 Cell growth and death
   04216 Ferroptosis
    4891 (SLC11A2)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    4891 (SLC11A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4891 (SLC11A2)
   05012 Parkinson disease
    4891 (SLC11A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4891 (SLC11A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC11: Proton-coupled metal ion transporter
   4891 (SLC11A2)
SSDB
Motif
Pfam: Nramp
Other DBs
NCBI-GeneID: 4891
NCBI-ProteinID: NP_001167597
OMIM: 600523
HGNC: 10908
Ensembl: ENSG00000110911
Pharos: P49281(Tchem)
UniProt: P49281 A0A0X8GKR4
Structure
LinkDB
Position
12:complement(50952263..51028886)
AA seq 568 aa
MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEE
EYSCFSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATLVGLLLQR
LAARLGVVTGLHLAEVCHRQYPKVPRVILWLMVELAIIGSDMQEVIGSAIAINLLSVGRI
PLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITIMALTFGYEYVTVKPSQSQVLKGM
FVPSCSGCRTPQIEQAVGIVGAVIMPHNMYLHSALVKSRQVNRNNKQEVREANKYFFIES
CIALFVSFIINVFVVSVFAEAFFGKTNEQVVEVCTNTSSPHAGLFPKDNSTLAVDIYKGG
VVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVVLTRSIAI
IPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSDFANGLGWRIAG
GILVLIICSINMYFVVVYVRDLGHVALYVVAAVVSVAYLGFVFYLGWQCLIALGMSFLDC
GHTCHLGLTAQPELYLLNTMDADSLVSR
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggtgctgggtcctgaacagaagatgtcagatgacagtgtttctggagatcatggggag
tctgccagtcttggtaacatcaaccctgcctatagtaatccctctctttcacagtcccct
ggggactcagaggagtacttcgccacttactttaatgagaagatctccattcctgaggag
gagtactcttgttttagctttcgtaaactctgggctttcaccggaccaggttttcttatg
agcattgcctacctggatccaggaaatattgaatccgatttgcagtctggagcagtggct
ggatttaagttgctctggatccttctgttggccacccttgtggggctgctgctccagcgg
cttgcagctagactgggagtggttactgggctgcatcttgctgaagtatgtcaccgtcag
tatcccaaggtcccacgagtcatcctgtggctgatggtggagttggctatcatcggctca
gacatgcaagaagtcattggctcagccattgctatcaatcttctgtctgtaggaagaatt
cctctgtggggtggcgttctcatcaccattgcagatacttttgtatttctcttcttggac
aaatatggcttgcggaagctagaagcattttttggctttctcatcactattatggccctc
acatttggatatgagtatgttacagtgaaacccagccagagccaggtactcaagggcatg
ttcgtaccatcctgttcaggctgtcgcactccacagattgaacaggctgtgggcatcgtg
ggagctgtcatcatgccacacaacatgtacctgcattctgccttagtcaagtctagacag
gtaaaccggaacaataagcaggaagttcgagaagccaataagtactttttcattgaatcc
tgcattgcactctttgtttccttcatcatcaatgtctttgttgtctcagtctttgctgaa
gcattttttgggaaaaccaacgagcaggtggttgaagtctgtacaaataccagcagtcct
catgctggcctctttcctaaagataactcgacactggctgtggacatctacaaagggggt
gttgtgctgggatgttactttgggcctgctgcactctacatttgggcagtggggatcctg
gctgcaggacagagctccaccatgacaggaacctattctggccagtttgtcatggaggga
ttcctgaacctaaagtggtcacgctttgcccgagtggttctgactcgctctattgccatc
atccccactctgcttgttgctgtcttccaagatgtagagcatctaacagggatgaatgac
tttctgaatgttctacagagcttacagcttccctttgctctcatacccatcctcacattt
acgagcttgcggccagtaatgagtgactttgccaatggactaggctggcggattgcagga
ggaatcttggtccttatcatctgttccatcaatatgtactttgtagtggtttatgtccgg
gacctagggcatgtggcattatatgtggtggctgctgtggtcagcgtggcttatctgggc
tttgtgttctacttgggttggcaatgtttgattgcactgggcatgtccttcctggactgt
gggcatacgtgccatctgggattgacagctcagcctgaactctatcttctgaacaccatg
gacgctgactcacttgtgtctagatga

DBGET integrated database retrieval system