KEGG   Homo sapiens (human): 493869
Entry
493869            CDS       T01001                                 
Symbol
GPX8, EPLA847, GPx-8, GSHPx-8, UNQ847
Name
(RefSeq) glutathione peroxidase 8 (putative)
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04918  Thyroid hormone synthesis
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    493869 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    493869 (GPX8)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    493869 (GPX8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    493869 (GPX8)
   05016 Huntington disease
    493869 (GPX8)
   05022 Pathways of neurodegeneration - multiple diseases
    493869 (GPX8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     493869 (GPX8)
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF6693
Other DBs
NCBI-GeneID: 493869
NCBI-ProteinID: NP_001008398
OMIM: 617172
HGNC: 33100
Ensembl: ENSG00000164294
Pharos: Q8TED1(Tbio)
UniProt: Q8TED1
Structure
LinkDB
Position
5:55160171..55167297
AA seq 209 aa
MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV
SLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSK
EVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WKPEEPIEVIRPDIAALVRQVIIKKKEDL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggagcctcttgcagcttacccgctaaaatgttccgggcccagagcaaaggtatttgca
gttttgctgtctatagttctatgcacagtaacgctatttcttctacaactaaaattcctc
aaacctaaaatcaacagcttttatgcctttgaagtgaaggatgcaaaaggaagaactgtt
tctctggaaaagtataaaggcaaagtttcactagttgtaaacgtggccagtgactgccaa
ctcacagacagaaattacttagggctgaaggaactgcacaaagagtttggaccatcccac
ttcagcgtgttggcttttccctgcaatcagtttggagaatcggagccccgcccaagcaag
gaagtagaatcttttgcaagaaaaaactacggagtaactttccccatcttccacaagatt
aagattctaggatctgaaggagaacctgcatttagatttcttgttgattcttcaaagaag
gaaccaaggtggaatttttggaagtatcttgtcaaccctgagggtcaagttgtgaagttc
tggaagccagaggagcccattgaagtcatcaggcctgacatagcagctctggttagacaa
gtgatcataaaaaagaaagaggatctatga

DBGET integrated database retrieval system