KEGG   Homo sapiens (human): 4973
Entry
4973              CDS       T01001                                 
Symbol
OLR1, CLEC8A, LOX1, LOXIN, SCARE1, SLOX1
Name
(RefSeq) oxidized low density lipoprotein receptor 1
  KO
K08763  oxidised low-density lipoprotein receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04145  Phagosome
hsa05417  Lipid and atherosclerosis
Disease
H01730  Myocardial infarction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4973 (OLR1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    4973 (OLR1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    4973 (OLR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4973 (OLR1)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    4973 (OLR1)
   04091 Lectins [BR:hsa04091]
    4973 (OLR1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    4973 (OLR1)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   4973 (OLR1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   4973 (OLR1)
SSDB
Motif
Pfam: Lectin_C Ly49 UL45 FAM176 CENP-Q DUF1664 Vpu DUF4446 zf-ZPR1 OSTbeta DUF1690 Exonuc_VII_L LMBR1 SMP_2
Other DBs
NCBI-GeneID: 4973
NCBI-ProteinID: NP_002534
OMIM: 602601
HGNC: 8133
Ensembl: ENSG00000173391
Pharos: P78380(Tbio)
UniProt: P78380 A0A024RAU0
Structure
LinkDB
Position
12:complement(10158301..10176266)
AA seq 273 aa
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQL
SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ
MELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLL
KINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPS
GTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
NT seq 822 nt   +upstreamnt  +downstreamnt
atgacttttgatgacctaaagatccagactgtgaaggaccagcctgatgagaagtcaaat
ggaaaaaaagctaaaggtcttcagtttctttactctccatggtggtgcctggctgctgcg
actctaggggtcctttgcctgggattagtagtgaccattatggtgctgggcatgcaatta
tcccaggtgtctgacctcctaacacaagagcaagcaaacctaactcaccagaaaaagaaa
ctggagggacagatctcagcccggcaacaagcagaagaagcttcacaggagtcagaaaac
gaactcaaggaaatgatagaaacccttgctcggaagctgaatgagaaatccaaagagcaa
atggaacttcaccaccagaatctgaatctccaagaaacactgaagagagtagcaaattgt
tcagctccttgtccgcaagactggatctggcatggagaaaactgttacctattttcctcg
ggctcatttaactgggaaaagagccaagagaagtgcttgtctttggatgccaagttgctg
aaaattaatagcacagctgatctggacttcatccagcaagcaatttcctattccagtttt
ccattctggatggggctgtctcggaggaaccccagctacccatggctctgggaggacggt
tctcctttgatgccccacttatttagagtccgaggcgctgtctcccagacatacccttca
ggtacctgtgcatatatacaacgaggagctgtttatgcggaaaactgcattttagctgcc
ttcagtatatgtcagaagaaggcaaacctaagagcacagtga

DBGET integrated database retrieval system