Homo sapiens (human): 49861 Help Entry 49861             CDS       T01001                                  Symbol CLDN20 Name (RefSeq) claudin 20   KO K06087   claudin Organism hsa  Homo sapiens (human) Pathway hsa03272   Virion - Hepatitis viruses hsa04514   Cell adhesion molecules hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa05130   Pathogenic Escherichia coli infection hsa05160   Hepatitis C Network nt06180  Pathogenic Escherichia coli   Element N01287   Tight junction-Actin signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     49861 (CLDN20)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     49861 (CLDN20)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     49861 (CLDN20)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     49861 (CLDN20)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     49861 (CLDN20)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     49861 (CLDN20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     49861 (CLDN20)    04147 Exosome [BR:hsa04147]     49861 (CLDN20) Cilium and associated proteins [BR:hsa03037]  Other cilia and associated proteins   Stereociliary proteins    49861 (CLDN20) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    49861 (CLDN20)   Exosomal proteins of colorectal cancer cells    49861 (CLDN20) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Clc-like DUF981 Motif Other DBs NCBI-GeneID:  49861 NCBI-ProteinID:  NP_001001346 HGNC:  2042 Ensembl:  ENSG00000171217 UniProt:  P56880 A0A140VKA2 LinkDB All DBs Position 6:155264013..155276548 Genome browser AA seq 219 aa AA seqDB search MASAGLQLLAFILALSGVSGVLTATLLPNWKVNVDVDSNIITAIVQLHGLWMDCTWYSTG MFSCALKHSILSLPIHVQAARATMVLACVLSALGICTSTVGMKCTRLGGDRETKSHASFA GGVCFMSAGISSLISTVWYTKEIIANFLDLTVPESNKHEPGGAIYIGFISAMLLFISGMI FCTSCIKRNPEARLDPPTQQPISNTQLENNSTHNLKDYV NT seq 660 nt NT seq  +upstreamnt  +downstreamnt atggcctcagcaggactccagctccttgctttcatcctggccttatctggggtctctgga gtgctcacagccactctgctgcccaactggaaggtgaatgtggatgtggactccaacatc ataacagccattgtacagctgcacgggctctggatggactgtacgtggtacagcactggg atgttcagctgtgccctgaaacactccattctgtccctccccatccacgtgcaggctgcg agagccaccatggtcctggcgtgtgttctgtctgctttggggatctgcacttccacagta ggaatgaaatgtactcgcttaggaggggacagagaaaccaagagccatgcttcctttgct ggaggagtctgtttcatgtctgcaggaatctctagtttaatctcgacagtgtggtacaca aaggagatcatagcaaactttctggatctgacagttccagaaagcaacaaacatgaacct ggaggagctatctatatcggattcatttctgcaatgctgttgtttatctctggcatgatt ttctgcacctcctgtataaaaaggaatccagaagctagactcgacccacccacacagcag cctatctctaacacacagctcgagaacaattccacacacaatctgaaggattatgtgtaa

DBGET integrated database retrieval system