Homo sapiens (human): 5010 Help Entry 5010              CDS       T01001                                  Symbol CLDN11, HLD22, OSP, OTM Name (RefSeq) claudin 11   KO K06087   claudin Organism hsa  Homo sapiens (human) Pathway hsa03272   Virion - Hepatitis viruses hsa04382   Cornified envelope formation hsa04514   Cell adhesion molecules hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa05130   Pathogenic Escherichia coli infection hsa05160   Hepatitis C Network nt06180  Pathogenic Escherichia coli   Element N01287   Tight junction-Actin signaling pathway Disease H00679   Hypomyelinating leukodystrophy Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     5010 (CLDN11)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     5010 (CLDN11)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     5010 (CLDN11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     5010 (CLDN11)   09158 Development and regeneration    04382 Cornified envelope formation     5010 (CLDN11)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     5010 (CLDN11)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     5010 (CLDN11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     5010 (CLDN11)    04147 Exosome [BR:hsa04147]     5010 (CLDN11) Cilium and associated proteins [BR:hsa03037]  Other cilia and associated proteins   Stereociliary proteins    5010 (CLDN11) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    5010 (CLDN11)   Exosomal proteins of colorectal cancer cells    5010 (CLDN11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 zf-LITAF-like MTABC_N Motif Other DBs NCBI-GeneID:  5010 NCBI-ProteinID:  NP_005593 OMIM:  601326 HGNC:  8514 Ensembl:  ENSG00000013297 UniProt:  O75508 LinkDB All DBs Position 3:170418868..170434691 Genome browser AA seq 207 aa AA seqDB search MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRA QLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAG DAQAFGENRFYYTAGSSSPTHAKSAHV NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggtggccacgtgcctgcaggtggtgggcttcgtcacgagcttcgtgggctggatcggg gtcatcgtgaccacctccaccaatgactgggtggtgacctgcggctacaccatccccacc tgccgcaagctggatgagctgggctccaaggggctgtgggccgactgcgtcatggccacg gggctgtaccactgcaagcccctggtggacatcctcatcctgccgggctacgtgcaggcc tgccgcgccctgatgattgctgcctcggtcctgggtctgccggccattttactgctgctg actgttcttccctgcatccggatgggccaggagcccggtgtggctaagtacaggcgggcc cagctggctggtgttttgctcattctgctggctctctgcgcccttgttgccaccatctgg ttccctgtgtgcgcccaccgtgagaccaccatcgtgagctttggctactccctgtatgca ggctggattggtgctgtgctgtgcctcgtgggtggctgtgtcatcctctgctgcgctgga gatgcccaggcctttggtgaaaaccgtttctactacactgcgggctctagctccccgact catgcgaagagtgcccacgtataa

DBGET integrated database retrieval system