KEGG   Homo sapiens (human): 51720
Entry
51720             CDS       T01001                                 
Symbol
UIMC1, RAP80, X2HRIP110
Name
(RefSeq) ubiquitin interaction motif containing 1
  KO
K20775  BRCA1-A complex subunit RAP80
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    51720 (UIMC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    51720 (UIMC1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     51720 (UIMC1)
SSDB
Motif
Pfam: RAP80_UIM UIM Rad50_zn_hook
Other DBs
NCBI-GeneID: 51720
NCBI-ProteinID: NP_001186226
OMIM: 609433
HGNC: 30298
Ensembl: ENSG00000087206
Pharos: Q96RL1(Tbio)
UniProt: Q96RL1 A0A024R7R0
Structure
LinkDB
Position
5:complement(176905005..177022602)
AA seq 719 aa
MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKT
KTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNS
CRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEERE
EPWDHTEKTEEEPVSGSSGSWDQSSQPVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRG
SAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQL
EVYQKSLKMAQRQLLNKKGFGEPVLPRPPSLIQNECGQGEQASEKNECISEDMGDEDKEE
RQESRASDWHSKTKDFQESSIKSLKEKLLLEEEPTTSHGQSSQGIVEETSEEGNSVPASQ
SVAALTSKRSLVLMPESSAEEITVCPETQLSSSETFDLEREVSPGSRDILDGVRIIMADK
EVGNKEDAEKEVAISTFSSSNQVSCPLCDQCFPPTKIERHAMYCNGLMEEDTVLTRRQKE
AKTKSDSGTAAQTSLDIDKNEKCYLCKSLVPFREYQCHVDSCLQLAKADQGDGPEGSGRA
CSTVEGKWQQRLKNPKEKGHSEGRLLSFLEQSEHKTSDADIKSSETGAFRVPSPGMEEAG
CSREMQSSFTRRDLNESPVKSFVSISEATDCLVDFKKQVTVQPGSRTRTKAGRGRRRKF
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgccacggagaaagaaaaaagttaaagaagtctccgaatctcggaacctggagaagaag
gatgtggaaactaccagttctgtcagtgtgaagaggaagcgtagacttgaggatgcattc
attgtgatatccgatagtgatggagaggaaccaaaggaggaaaatgggttgcagaaaacg
aagacaaaacagtcgaatagagcaaagtgtttggccaaaagaaaaatcgcacagatgaca
gaagaagaacagtttgctctggctctcaaaatgagtgagcaggaagctagggaggtgaac
agccaggaggaggaagaagaggagctcttgaggaaagccattgctgaaagcctgaatagt
tgccggccttctgatgcttccgctaccagatctcgacctctggccactggaccgtcttcc
cagtcccatcaagagaaaaccacagactctgggctcactgaaggcatatggcagctggta
cctccatcactgtttaaaggctcacatatcagtcagggaaacgaggctgaggaaagagag
gagccttgggaccacactgaaaaaactgaagaggagccggtctctggcagctcaggaagc
tgggaccagtcaagccagccagtgtttgagaatgtgaacgttaaatcttttgacagatgt
actggccactcggctgagcacacacagtgtgggaagccacaggaaagtactgggaggggt
tctgcttttctcaaagctgtccagggtagcggggacacatctaggcactgtctacctacc
ctagcagatgccaaaggtctccaggacactgggggcactgtgaactatttctggggtatt
ccattctgccctgatggagtagaccctaaccagtataccaaggtcattctctgccagttg
gaggtttatcaaaagagcctgaaaatggctcagaggcagctccttaataaaaaaggtttt
ggggaaccagtgttacctagacctccttctctgatccagaatgaatgtggccaaggagag
caggctagtgagaaaaatgaatgcatctcagaagatatgggagatgaagacaaagaggag
aggcaggagtctagggcatctgactggcactcaaaaaccaaggatttccaggaaagctca
attaaaagcttgaaagagaaacttttgttggaggaagaaccaacaaccagtcatggtcag
tcttcccaagggattgttgaagaaacttctgaagagggaaactctgtacctgcttcacaa
agtgttgctgctttgaccagtaagagaagcttagtccttatgccagagagttctgcagaa
gaaatcactgtttgtcctgagacccagctaagttcctctgaaacttttgaccttgaaaga
gaagtctctccaggtagcagagatatcttggatggagtcagaataataatggcagataag
gaggttggtaacaaggaagatgctgagaaggaagtagctatttctaccttctcatccagt
aaccaggtatcctgcccgctatgtgaccaatgctttccacccacaaagattgaacgacat
gccatgtactgcaatggtctgatggaggaagatacagtattgactcggagacaaaaagag
gccaagaccaagagtgacagtgggacagctgcccagacttctctagacattgacaagaat
gagaagtgttacctctgtaaatccctggtcccatttagagagtatcagtgtcatgtggac
tcctgtctccagcttgcaaaggctgaccaaggagatggacctgaagggagtggaagagca
tgttcaactgtggaggggaagtggcagcagaggctgaagaacccaaaggaaaaaggccac
agtgaaggccgactccttagtttcttggaacagtctgagcacaagacttcagatgcagac
atcaagtcttcagaaacaggagccttcagggtgccttcaccagggatggaagaggcaggc
tgcagcagagagatgcagagttctttcacacgtcgtgacttaaatgaatctcccgtcaag
tcttttgtttccatttcagaagccacagattgcttagtggactttaaaaagcaagttact
gtccagccaggtagtcggacacggaccaaagctggcagaggaagaaggagaaaattctga

DBGET integrated database retrieval system