KEGG   Homo sapiens (human): 53371
Entry
53371             CDS       T01001                                 
Symbol
NUP54
Name
(RefSeq) nucleoporin 54
  KO
K14308  nuclear pore complex protein Nup54
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    53371 (NUP54)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    53371 (NUP54)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    53371 (NUP54)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     53371 (NUP54)
SSDB
Motif
Pfam: Nup54 Nup54_C XhlA FAST_2
Other DBs
NCBI-GeneID: 53371
NCBI-ProteinID: NP_059122
OMIM: 607607
HGNC: 17359
Ensembl: ENSG00000138750
Vega: OTTHUMG00000130098
Pharos: Q7Z3B4(Tdark)
UniProt: Q7Z3B4
Structure
LinkDB
Position
4:complement(76114664..76148397)
AA seq 507 aa
MAFNFGAPSGTSGTAAATAAPAGGFGGFGTTSTTAGSAFSFSAPTNTGTTGLFGGTQNKG
FGFGTGFGTTTGTSTGLGTGLGTGLGFGGFNTQQQQQTTLGGLFSQPTQAPTQSNQLINT
ASALSAPTLLGDERDAILAKWNQLQAFWGTGKGYFNNNIPPVEFTQENPFCRFKAVGYSC
MPSNKDEDGLVVLVFNKKETEIRSQQQQLVESLHKVLGGNQTLTVNVEGTKTLPDDQTEV
VIYVVERSPNGTSRRVPATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNP
PAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTRLDIISEDISE
LQKNQTTSVAKIAQYKRKLMDLSHRTLQVLIKQEIQRKSGYAIQADEEQLRVQLDTIQGE
LNAPTQFKGRLNELMSQIRMQNHFGAVRSEERYYIDADLLREIKQHLKQQQEGLSHLISI
IKDDLEDIKLVEHGLNETIHIRGGVFS
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggccttcaattttggggctccctcgggcacctccggtaccgctgcagccaccgcggcc
cccgcgggtgggtttggaggatttgggacaacatctacaactgcaggttctgcattcagc
ttttctgccccaactaacacaggcactactggactctttggtggtactcagaacaaaggt
tttggatttggtactggttttggcacaacaacgggaactagtactggtttaggtactggt
ttgggaactggactgggatttggaggatttaatacacagcagcagcagcaaactacatta
ggtggtctcttcagtcagcctacacaagctcctacccagtccaaccagctgataaatact
gcgagtgctctttctgctccaacgctgttgggagatgagagagatgctattttggcaaaa
tggaatcaactgcaggccttttggggaacaggaaaagggtatttcaacaataatattccg
ccagtggaattcacacaagaaaatcccttttgccgatttaaggcagtaggttatagttgc
atgcccagtaataaagatgaagatgggctagtggttttagttttcaacaaaaaagaaaca
gagattcgaagccaacaacaacagttggtagaatcattgcataaagttttgggaggaaac
cagacccttactgtaaatgtagagggcactaaaacattgccagatgatcagacagaagtt
gttatttatgttgttgagcgttcgccaaatggtacttcaagaagagttccagctacaacg
ctatatgcccattttgaacaagccaatataaaaacacaattgcagcaacttggtgtaacc
ctttctatgactagaacagaactttctcctgcacagatcaaacagcttttacagaatcct
cctgctggtgttgatcctattatctgggaacaggccaaggtagataaccctgattctgaa
aagttaattcctgtaccaatggtgggttttaaggaacttctccgaagactgaaggttcaa
gatcagatgactaagcagcatcaaaccagattagatatcatatctgaagatattagtgag
ctacaaaagaatcaaactacatctgtagccaaaattgcacaatacaagaggaaactcatg
gatctttcccatagaactttacaggtcctaatcaaacaggaaattcaaaggaagagtggt
tatgccattcaggctgatgaagagcagttgcgagttcagctggatacgattcagggtgaa
ctaaatgcacctactcagttcaagggccgactaaatgaattgatgtctcaaatcaggatg
cagaatcattttggagcagtcagatctgaagaaaggtattacatagatgcagatctgtta
cgagaaatcaagcagcatttgaaacaacaacaggaaggccttagccatttgattagcatc
attaaagacgatctagaagatataaagctggtcgaacatggattgaatgaaaccatccac
atcagaggtggtgtctttagttga

DBGET integrated database retrieval system