KEGG Orthology (KO) [BR:hsa00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
5437 (POLR2H)
09124 Replication and repair
03420 Nucleotide excision repair
5437 (POLR2H)
09160 Human Diseases
09164 Neurodegenerative disease
05016 Huntington disease
5437 (POLR2H)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:hsa03021]
5437 (POLR2H)
03400 DNA repair and recombination proteins [BR:hsa03400]
5437 (POLR2H)
Transcription machinery [BR:hsa03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
5437 (POLR2H)
RNA polymerase III system
RNA polymerase III
5437 (POLR2H)
RNA polymerase I system
RNA polymerase I
5437 (POLR2H)
DNA repair and recombination proteins [BR:hsa03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
5437 (POLR2H)
150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF