KEGG   Homo sapiens (human): 54511
Entry
54511             CDS       T01001                                 
Symbol
HMGCLL1, ERCHL, bA418P12.1, er-cHL
Name
(RefSeq) 3-hydroxymethyl-3-methylglutaryl-CoA lyase like 1
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Module
hsa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Network
nt06024  Valine, leucine and isoleucine degradation
  Element
N00851  Leucine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    54511 (HMGCLL1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    54511 (HMGCLL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    54511 (HMGCLL1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     54511 (HMGCLL1)
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-GeneID: 54511
NCBI-ProteinID: NP_061909
OMIM: 619050
HGNC: 21359
Ensembl: ENSG00000146151
Pharos: Q8TB92(Tbio)
UniProt: Q8TB92 O95896
LinkDB
Position
6:complement(55434373..55678919)
AA seq 370 aa
MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQTSLLTNLHCFQPDVSGFSVSLAGT
VACIHWETSQLSGLPEFVKIVEVGPRDGLQNEKVIVPTDIKIEFINRLSQTGLSVIEVTS
FVSSRWVPQMADHTEVMKGIHQYPGVRYPVLTPNLQGFHHAVAAGATEISVFGAASESFS
KKNINCSIEESMGKFEEVVKSARHMNIPARGYVSCALGCPYEGSITPQKVTEVSKRLYGM
GCYEISLGDTIGVGTPGSMKRMLESVMKEIPPGALAVHCHDTYGQALANILTALQMGINV
VDSAVSGLGGCPYAKGASGNVATEDLIYMLNGLGLNTGVNLYKVMEAGDFICKAVNKTTN
SKVAQASFNA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggaatgtgccatccgcggtgaagcactgcctcagctaccagcagcttctccgggag
catctctggatcggggattcagtggcaggggcgctcgaccccgcgcagacttctcttcta
acaaaccttcactgctttcagcccgatgtctctggcttctcagtctccttggcaggcacg
gtggcttgtatccactgggaaacatcccagttatctggactccctgagtttgttaaaata
gtagaagttgggcctagggatggattgcagaatgaaaaggttatagttcctacagatata
aaaattgaatttatcaatcgactttcccaaactggcttgtctgtaatagaagtgactagc
tttgtgtcttccagatgggtaccacagatggctgatcacactgaagtaatgaaaggcatt
catcaatatccaggagttcgctatcctgtccttactcctaatcttcagggttttcaccat
gctgttgctgctggagctactgagatatcagtttttggagctgcatctgaatcctttagc
aagaagaatattaactgttccattgaagaaagtatgggaaaatttgaggaggttgttaag
tctgcaagacacatgaatattccagcacgagggtatgtgtcttgtgctctgggctgtcca
tatgaaggaagtattacaccgcaaaaagtgacagaagtgtctaagagattgtacggcatg
ggttgttatgagatctctctaggagacacaattggagtgggaactccaggaagtatgaaa
agaatgttggaaagtgtgatgaaagaaatcccaccaggtgctcttgctgttcactgtcat
gacacatacggacaagccttagcaaatatccttacggcccttcagatgggaattaatgtg
gtggactccgcagtatccggattaggtggctgcccttatgcaaaaggtgcttctgggaat
gtagccactgaggatttgatatatatgcttaatggcctggggctcaatacaggtgtgaat
ctatacaaagtgatggaagctggtgactttatttgcaaagctgtgaataaaaccacaaac
tctaaagtagcacaagcctccttcaatgcttga

DBGET integrated database retrieval system