KEGG   Homo sapiens (human): 54657
Entry
54657             CDS       T01001                                 

Gene name
UGT1A4, GNT1, HUG-BR2, UDPGT, UDPGT_1-4, UGT-1A, UGT-1D, UGT1, UGT1-01, UGT1-04, UGT1.1, UGT1.4, UGT1A, UGT1A1, UGT1A4S, UGT1D, hUG-BR1
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
hsa04976  Bile secretion
hsa05204  Chemical carcinogenesis - DNA adducts
hsa05207  Chemical carcinogenesis - receptor activation
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    54657 (UGT1A4)
   00053 Ascorbate and aldarate metabolism
    54657 (UGT1A4)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    54657 (UGT1A4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    54657 (UGT1A4)
   00860 Porphyrin and chlorophyll metabolism
    54657 (UGT1A4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    54657 (UGT1A4)
   00982 Drug metabolism - cytochrome P450
    54657 (UGT1A4)
   00983 Drug metabolism - other enzymes
    54657 (UGT1A4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    54657 (UGT1A4)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    54657 (UGT1A4)
   05207 Chemical carcinogenesis - receptor activation
    54657 (UGT1A4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    54657 (UGT1A4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     54657 (UGT1A4)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   54657 (UGT1A4)
SSDB
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 54657
NCBI-ProteinID: NP_009051
OMIM: 606429
HGNC: 12536
Ensembl: ENSG00000244474
Vega: OTTHUMG00000059119
Pharos: P22310(Tbio)
UniProt: P22310
LinkDB
Position
2q37.1
AA seq 534 aa
MARGLQVPLPRLATGLLLLLSVQPWAESGKVLVVPTDGSPWLSMREALRELHARGHQAVV
LTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNV
SLALHRCCVELLHNEALIRHLNATSFDVVLTDPVNLCGAVLAKYLSIPAVFFWRYIPCDL
DFKGTQCPNPSSYIPKLLTTNSDHMTFLQRVKNMLYPLALSYICHTFSAPYASLASELFQ
REVSVVDLVSYASVWLFRGDFVMDYPRPIMPNMVFIGGINCANGKPLSQEFEAYINASGE
HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQND
LLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMT
SEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAH
DLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggccagaggactccaggttcccctgccgcggctggccacaggactgctgctcctcctc
agtgtccagccctgggctgagagtggaaaggtgttggtggtgcccactgatggcagcccc
tggctcagcatgcgggaggccttgcgggagctccatgccagaggccaccaggcggtggtc
ctcaccccagaggtgaatatgcacatcaaagaagagaaatttttcaccctgacagcctat
gctgttccatggacccagaaggaatttgatcgcgttacgctgggctacactcaagggttc
tttgaaacagaacatcttctgaagagatattctagaagtatggcaattatgaacaatgta
tctttggcccttcataggtgttgtgtggagctactgcataatgaggccctgatcaggcac
ctgaatgctacttcctttgatgtggttttaacagaccccgttaacctctgtggggcggtg
ctggctaagtacctgtcgattcctgctgtgtttttttggaggtacattccatgtgactta
gactttaagggcacacagtgtccaaatccttcctcctatattcctaagttactaacgacc
aattcagaccacatgacattcctgcaaagggtcaagaacatgctctaccctctggccctg
tcctacatttgccatactttttctgccccttatgcaagtcttgcctctgagctttttcag
agagaggtgtcagtggtggatcttgtcagctatgcatccgtgtggctgttccgaggggac
tttgtgatggactaccccaggccgatcatgcccaacatggtcttcattgggggcatcaac
tgtgccaacgggaagccactatctcaggaatttgaagcctacattaatgcttctggagaa
catggaattgtggttttctctttgggatcaatggtctcagaaattccagagaagaaagct
atggcaattgctgatgctttgggcaaaatccctcagacagtcctgtggcggtacactgga
acccgaccatcgaatcttgcgaacaacacgatacttgttaagtggctaccccaaaacgat
ctgcttggtcacccgatgacccgtgcctttatcacccatgctggttcccatggtgtttat
gaaagcatatgcaatggcgttcccatggtgatgatgcccttgtttggtgatcagatggac
aatgcaaagcgcatggagactaagggagctggagtgaccctgaatgttctggaaatgact
tctgaagatttagaaaatgctctaaaagcagtcatcaatgacaaaagttacaaggagaac
atcatgcgcctctccagccttcacaaggaccgcccggtggagccgctggacctggccgtg
ttctgggtggagtttgtgatgaggcacaagggcgcgccacacctgcgccccgcagcccac
gacctcacctggtaccagtaccattccttggacgtgattggtttcctcttggccgtcgtg
ctgacagtggccttcatcacctttaaatgttgtgcttatggctaccggaaatgcttgggg
aaaaaagggcgagttaagaaagcccacaaatccaagacccattga

DBGET integrated database retrieval system