KEGG   Homo sapiens (human): 54880
Entry
54880             CDS       T01001                                 
Symbol
BCOR, ANOP2, MAA2, MCOPS2
Name
(RefSeq) BCL6 corepressor
  KO
K23215  bcl-6 corepressor
Organism
hsa  Homo sapiens (human)
Pathway
hsa03083  Polycomb repressive complex
Network
nt06523  Epigenetic regulation by Polycomb complexes
  Element
N01586  Activation of PRC2.2 by ubiquitination of H2AK119
Disease
H02170  Microphthalmia, syndromic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09126 Chromosome
   03083 Polycomb repressive complex
    54880 (BCOR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    54880 (BCOR)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     54880 (BCOR)
SSDB
Motif
Pfam: BCOR PUFD Ank_2 Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 54880
NCBI-ProteinID: NP_001116857
OMIM: 300485
HGNC: 20893
Ensembl: ENSG00000183337
UniProt: Q6W2J9
LinkDB
Position
X:complement(40051246..40177329)
AA seq 1755 aa
MLSATPLYGNVHSWMNSERVRMCGASEDRKILVNDGDASKARLELREENPLNHNVVDAST
AHRIDGLAALSMDRTGLIREGLRVPGNIVYSSLCGLGSEKGREAATSTLGGLGFSSERNP
EMQFKPNTPETVEASAVSGKPPNGFSAIYKTPPGIQKSAVATAEALGLDRPASDKQSPLN
INGASYLRLPWVNPYMEGATPAIYPFLDSPNKYSLNMYKALLPQQSYSLAQPLYSPVCTN
GERFLYLPPPHYVGPHIPSSLASPMRLSTPSASPAIPPLVHCADKSLPWKMGVSPGNPVD
SHAYPHIQNSKQPRVPSAKAVTSGLPGDTALLLPPSPRPSPRVHLPTQPAADTYSEFHKH
YARISTSPSVALSKPYMTVSSEFPAARLSNGKYPKAPEGGEGAQPVPGHARKTAVQDRKD
GSSPPLLEKQTVTKDVTDKPLDLSSKVVDVDASKADHMKKMAPTVLVHSRAGSGLVLSGS
EIPKETLSPPGNGCAIYRSEIISTAPSSWVVPGPSPNEENNGKSMSLKNKALDWAIPQQR
SSSCPRMGGTDAVITNVSGSVSSAGRPASASPAPNANADGTKTSRSSVETTPSVIQHVGQ
PPATPAKHSSSTSSKGAKASNPEPSFKANENGLPPSSIFLSPNEAFRSPPIPYPRSYLPY
PAPEGIAVSPLSLHGKGPVYPHPVLLPNGSLFPGHLAPKPGLPYGLPTGRPEFVTYQDAL
GLGMVHPMLIPHTPIEITKEEKPERRSRSHERARYEDPTLRNRFSEILETSSTKLHPDVP
TDKNLKPNPNWNQGKTVVKSDKLVYVDLLREEPDAKTDTNVSKPSFAAESVGQSAEPPKP
SVEPALQQHRDFIALREELGRISDFHETYTFKQPVFTVSKDSVLAGTNKENLGLPVSTPF
LEPPLGSDGPAVTFGKTQEDPKPFCVGSAPPSVDVTPTYTKDGADEAESNDGKVLKPKPS
KLAKRIANSAGYVGDRFKCVTTELYADSSQLSREQRALQMEGLQEDSILCLPAAYCERAM
MRFSELEMKEREGGHPATKDSEMCKFSPADWERLKGNQDKKPKSVTLEEAIAEQNESERC
EYSVGNKHRDPFEAPEDKDLPVEKYFVERQPVSEPPADQVASDMPHSPTLRVDRKRKVSG
DSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIEL
TGLHPKKQRHLLHLRERWEQQVSAADGKPGRQSRKEVTQATQPEAIPQGTNITEEKPGRK
RAEAKGNRSWSEESLKPSDNEQGLPVFSGSPPMKSLSSTSAGGKKQAQPSCAPASRPPAK
QQKIKENQKTDVLCADEEEDCQAASLLQKYTDNSEKPSGKRLCKTKHLIPQESRRGLPLT
GEYYVENADGKVTVRRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSP
QETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRDNAGYCA
LHEACARGWLNIVRHLLEYGADVNCSAQDGTRPLHDAVENDHLEIVRLLLSYGADPTLAT
YSGRTIMKMTHSELMEKFLTDYLNDLQGRNDDDASGTWDFYGSSVCEPDDESGYDVLANP
PGPEDQDDDDDAYSDVFEFEFSETPLLPCYNIQVSVAQGPRNWLLLSDVLKKLKMSSRIF
RCNFPNVEIVTIAEAEFYRQVSASLLFSCSKDLEAFNPESKELLDLVEFTNEIQTLLGSS
VEWLHPSDLASDNYW
NT seq 5268 nt   +upstreamnt  +downstreamnt
atgctctcagcaacccccctgtatgggaacgttcacagctggatgaacagcgagagggtc
cgcatgtgtggggcgagcgaagacaggaaaatccttgtaaatgatggtgacgcttcaaaa
gccagactggaactgagggaagagaatcccttgaaccacaacgtggtggatgcgagcacg
gcccataggatcgatggcctggcagcactgagcatggaccgcactggcctgatccgggaa
gggctgcgggtcccgggaaacatcgtctattctagcttgtgtggactgggctcagagaaa
ggtcgggaggctgccacaagcactctaggtggccttgggttttcttcggaaagaaatcca
gagatgcagttcaaaccgaatacacccgagacagtggaggcttctgccgtctctggaaaa
cccccaaatggcttcagtgctatatacaaaacaccgcctggaatacaaaaaagtgctgta
gccacagcagaagcgctgggcttggacaggcctgccagcgacaaacagagccctctcaac
atcaatggtgctagttatctgcggctgccctgggtcaatccttacatggagggtgccacg
ccagccatctaccctttcctcgactcgccaaataagtattcactgaacatgtacaaggcc
ttgctacctcagcagtcctacagcttggcccagccgctgtattctccagtctgcaccaat
ggggagcgctttctctacctgccgccacctcactacgtcggtccccacatcccatcgtcc
ttggcatcacccatgaggctctcgacaccttcggcctccccagccatcccgcctctcgtc
cattgcgcagacaaaagcctcccgtggaagatgggcgtcagccctgggaatcctgttgat
tcccacgcctatcctcacatccagaacagtaagcagcccagggttccctctgccaaggcg
gtcaccagtggcctgccgggggacacagctctcctgttgcccccctcgcctcggccgtca
ccccgagtccaccttcccacccagcctgctgcagacacctactcggagttccacaagcac
tatgccaggatctccacctctccttcagttgccctgtcaaagccatacatgacagttagc
agcgagttccccgcggccaggctctccaatggcaagtatcccaaggctccggaagggggc
gaaggtgcccagccagtgcccgggcatgcccggaagacagcggttcaagacagaaaagat
ggcagctcacctcctctgttggagaagcagaccgttaccaaagacgtcacagataagcca
ctagacttgtcttctaaagtggtggatgtagatgcttccaaagctgaccacatgaaaaag
atggctcccacggtcctggttcacagcagggctggaagtggcttagtgctctccggaagt
gagattccgaaagaaacactatctcctccaggaaatggttgtgctatctatagatctgaa
atcatcagcactgctccctcatcctgggtggtgcccgggccaagtcctaacgaagagaac
aatggcaaaagcatgtcgctgaaaaacaaggcattggactgggcgataccacagcagcgg
agttcatcatgcccgcgcatgggcggcaccgatgctgtcatcactaacgtttcagggtca
gtgtcgagtgcaggccgcccagcctccgcatcacccgcccccaatgccaatgcagatggc
accaaaaccagcaggagctctgtagaaaccacaccatccgttattcagcacgtgggccag
cccccggccactcctgccaagcacagtagcagcaccagcagcaagggcgccaaagccagc
aacccagaaccgagtttcaaagcaaacgagaacggccttccaccaagctctatatttctg
tctccaaatgaggcattcaggtccccaccaattccctaccccaggagttacctcccttac
ccagcccctgagggcattgctgtaagtcccctctccttacatggcaaaggacctgtctac
cctcacccagttttgttacccaatggcagtctgtttcctgggcaccttgccccaaagcct
gggctgccctatgggcttcccaccggccgtccagagtttgtgacctaccaagatgccctg
gggttgggcatggtgcatcccatgttgataccacacacgcccatagagattactaaagag
gagaaaccagagaggagatcccggtcccatgagagagcccgttacgaggacccaaccctc
cggaatcggttttccgagattttggaaactagcagcaccaagttacatccagatgtcccc
accgacaagaacctaaagccgaaccccaactggaatcaagggaagactgttgtcaaaagc
gacaagcttgtctacgtagaccttctccgagaagaaccagatgctaaaactgacacaaac
gtgtccaaacccagctttgcagcagagagtgttggccagagcgctgagccccccaagccc
tcagttgagccggccctgcagcagcaccgtgatttcatcgccctgagagaggagttgggg
cgcatcagtgacttccacgaaacttatactttcaaacagccagtcttcaccgtaagcaag
gacagtgttctggcaggtaccaacaaagagaacctagggttgccagtctcgactccattc
ctggagccacctctggggagcgatggccctgctgtaacttttggtaaaacccaagaggat
cccaaaccattttgtgtgggcagtgccccaccaagtgtggatgtgacccccacctatacc
aaagatggagctgatgaggctgaatcaaatgatggcaaagttctgaaaccgaagccatct
aagctggcaaagagaatcgccaactcagcgggttacgtgggtgaccgattcaaatgtgtc
actaccgaactgtatgcagattccagtcagctcagccgggagcaacgggcattgcagatg
gaaggattacaagaggacagtattttatgtctacccgctgcttactgtgagcgtgcaatg
atgcgcttctcagagttggagatgaaagaaagagaaggtggccacccagcaaccaaagac
tccgagatgtgcaaattcagcccagccgactgggaaaggttgaaaggaaatcaggacaaa
aagccaaagtcggtcaccctggaggaggccattgcagaacagaacgaaagtgagagatgc
gagtatagtgttggaaacaagcaccgtgatccctttgaagccccagaggacaaagatctt
cctgtggagaagtactttgtggagaggcagcctgtgagcgagcctcccgcagaccaggtg
gcctcggacatgcctcacagccccaccctccgggtggacaggaaacgcaaagtctcaggt
gacagcagccacactgagaccactgcggaggaggtgccagaggaccctctgctgaaagcc
aaacgccgacgagtctctaaagatgactggcctgagagggaaatgacaaacagttcctct
aaccacttagaagacccacattatagtgagctgaccaacctgaaggtgtgcattgaatta
acagggctccatcctaaaaaacaacgccacttgctgcaccttagagaacgatgggagcag
caggtgtcggcagcagatggcaaacctggccggcaaagcaggaaggaagtgacccaggcc
actcagcctgaggccattcctcaggggactaacatcactgaagagaaacctggcaggaaa
agggcagaggccaaaggcaacagaagctggtcggaagagtctcttaaacccagtgacaat
gaacaaggcttgcctgtgttctccggctctccgcccatgaagagtctttcatccaccagt
gcaggcggcaaaaagcaggctcagccaagctgcgcaccagcctccaggccgcctgccaaa
cagcagaaaattaaagaaaaccagaagacagatgtgctgtgtgcagacgaagaagaggat
tgccaggctgcctccctgctgcagaaatacaccgacaacagcgagaagccatccgggaag
agactgtgcaaaaccaaacacttgatccctcaggagtccaggcggggattgccactgaca
ggggaatactacgtggagaatgccgatggcaaggtgactgtccggagattcagaaagcgg
ccggagcccagttcggactatgatctgtcaccagccaagcaggagccaaagcccttcgac
cgcttgcagcaactgctaccagcctcccagtccacacagctgccatgctcaagttcccct
caggagaccacccagtctcgccctatgccgccggaagcacggagacttattgtcaataag
aacgctggcgagacccttctgcagcgggcagccaggcttggctatgaggaagtggtcctg
tactgcttagagaacaagatttgtgatgtaaatcatcgggacaacgcaggttactgcgcc
ctgcatgaagcttgtgctaggggctggctcaacattgtgcgacacctccttgaatatggc
gctgatgtcaactgtagtgcccaggatggaaccaggcctctgcacgatgctgttgagaac
gatcacttggaaattgtccgactacttctctcttatggtgctgaccccaccttggctacg
tactcaggtagaaccatcatgaaaatgacccacagtgaacttatggaaaagttcttaaca
gattatttaaatgacctccagggtcgcaatgatgatgacgccagtggcacttgggacttc
tatggcagctctgtttgtgaaccagatgatgaaagtggctatgatgttttagccaacccc
ccaggaccagaagaccaggatgatgatgacgatgcctatagcgatgtgtttgaatttgaa
ttttcagagacccccctcttaccgtgttataacatccaagtatctgtggctcaggggcca
cgaaactggctactgctttcggatgtccttaagaaattgaaaatgtcctcccgcatattt
cgctgcaattttccaaacgtggaaattgtcaccattgcagaggcagaattttatcggcag
gtttctgcaagtctcttgttctcttgctccaaagacctggaagccttcaaccctgaaagt
aaggagctgttagatctggtggaattcacgaacgaaattcagactctgctgggctcctct
gtagagtggctccaccccagtgatctggcctcagacaactactggtga

DBGET integrated database retrieval system