KEGG   Homo sapiens (human): 55034
Entry
55034             CDS       T01001                                 
Symbol
MOCOS, HMCS, MCS, MOS
Name
(RefSeq) molybdenum cofactor sulfurase
  KO
K15631  molybdenum cofactor sulfurtransferase [EC:2.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00790  Folate biosynthesis
hsa01100  Metabolic pathways
Network
nt06025  Molybdenum cofactor biosynthesis
  Element
N00890  Molybdenum cofactor biosynthesis
Disease
H00192  Xanthinuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    55034 (MOCOS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.9  molybdenum cofactor sulfurtransferase
     55034 (MOCOS)
SSDB
Motif
Pfam: MOSC_N Aminotran_5 MOSC
Other DBs
NCBI-GeneID: 55034
NCBI-ProteinID: NP_060417
OMIM: 613274
HGNC: 18234
Ensembl: ENSG00000075643
Vega: OTTHUMG00000132590
Pharos: Q96EN8(Tbio)
UniProt: Q96EN8
LinkDB
Position
18:36187497..36272157
AA seq 888 aa
MAGAAAESGRELWTFAGSRDPSAPRLAYGYGPGSLRELRAREFSRLAGTVYLDHAGATLF
SQSQLESFTSDLMENTYGNPHSQNISSKLTHDTVEQVRYRILAHFHTTAEDYTVIFTAGS
TAALKLVAEAFPWVSQGPESSGSRFCYLTDSHTSVVGMRNVTMAINVISTPVRPEDLWSA
EERSASASNPDCQLPHLFCYPAQSNFSGVRYPLSWIEEVKSGRLHPVSTPGKWFVLLDAA
SYVSTSPLDLSAHQADFVPISFYKIFGFPTGLGALLVHNRAAPLLRKTYFGGGTASAYLA
GEDFYIPRQSVAQRFEDGTISFLDVIALKHGFDTLERLTGGMENIKQHTFTLAQYTYVAL
SSLQYPNGAPVVRIYSDSEFSSPEVQGPIINFNVLDDKGNIIGYSQVDKMASLYNIHLRT
GCFCNTGACQRHLGISNEMVRKHFQAGHVCGDNMDLIDGQPTGSVRISFGYMSTLDDVQA
FLRFIIDTRLHSSGDWPVPQAHADTGETGAPSADSQADVIPAVMGRRSLSPQEDALTGSR
VWNNSSTVNAVPVAPPVCDVARTQPTPSEKAAGVLEGALGPHVVTNLYLYPIKSCAAFEV
TRWPVGNQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGMEPIEV
PLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKKHG
KDQLPGTMATLSLVNEAQYLLINTSSILELHRQLNTSDENGKEELFSLKDLSLRFRANII
INGKRAFEEEKWDEISIGSLRFQVLGPCHRCQMICIDQQTGQRNQHVFQKLSESRETKVN
FGMYLMHASLDLSSPCFLSVGSQVLPVLKENVEGHDLPASEKHQDVTS
NT seq 2667 nt   +upstreamnt  +downstreamnt
atggccggcgcggcggcggagtcagggcgggagctgtggaccttcgcgggttcccgggac
ccgagcgcaccgcggctagcctacggctacggcccgggcagcctgcgcgagctgcgggcg
cgcgagttcagccgcctggcaggaactgtctatcttgaccatgcaggtgccaccttgttc
tcccagagccagctcgaaagcttcactagtgatctcatggaaaacacttatggtaatcct
cacagccagaacatcagcagcaagctcacccatgacactgtggagcaggtgcgctacaga
atcctggcgcacttccacaccaccgcagaagactacactgtgatcttcactgccgggagc
acggctgctctcaaactggtggcagaggcctttccatgggtgtcccagggcccagagagc
agtgggagtcgcttctgttacctcaccgacagccacacctccgtagtgggtatgcggaac
gtgaccatggctataaatgtcatatccaccccggtcaggccagaggacctgtggtctgca
gaggaacgtagtgcttcagccagcaacccagactgccagctgccgcatctcttctgctac
ccagctcagagtaacttttctggagtcagataccccctgtcctggatagaagaggtcaag
tctgggcggttgcaccctgtgagcacgcctgggaagtggtttgtgctgctggatgcagcc
tcctacgtgagcacctcgcctttggacctgtcagctcaccaggccgactttgtccccatc
tccttctataagatcttcgggtttcctacaggcctgggcgctctgctggtccataatcgt
gcggctcctctactgaggaagacctactttggaggagggacagcctctgcgtacctagca
ggagaagacttctacatcccgaggcagtcggtagctcagaggtttgaagatggcaccatc
tcattccttgatgttatcgcgctaaaacatggatttgacaccctagagcgcctcacaggt
ggaatggagaatataaagcagcacaccttcaccttggctcagtatacctacgtggccctg
tcctctctccagtaccccaatggagcccctgtggtgcggatttacagcgattctgagttc
agcagccctgaggttcagggcccaatcatcaattttaatgtgctggatgacaaagggaac
atcattggttactcccaggtggacaaaatggccagtctttacaacatccacctgcgaact
ggctgcttctgtaacactggggcctgccagaggcacctgggcataagcaacgagatggtc
aggaagcattttcaggctggtcatgtctgtggggacaatatggacctcatagatgggcag
cccacaggatctgtgaggatttcatttggatacatgtcgacgctggatgatgtccaggcc
tttcttaggttcatcatagacactcgcctgcactcatcaggggactggcctgtccctcag
gcccatgctgacaccggggagactggagccccatcagcagacagccaggctgatgttata
cctgctgtcatgggcagacgtagcctctcgcctcaggaagatgccctcacaggctccagg
gtttggaacaactcgtctactgtgaatgctgtgcctgtggccccacctgtgtgtgatgtc
gccagaacccagccgactccttcagagaaagctgcaggagtcctggagggggcccttggg
ccacatgttgtcactaacctttatctctatccaatcaaatcctgtgctgcatttgaggtg
accaggtggcctgtaggaaaccaagggctgctatatgaccggagctggatggttgtgaat
cacaatggtgtttgcctgagtcagaagcaggaaccccggctctgcctgatccagcccttc
atcgacttgcggcaaaggatcatggtcatcaaagccaaagggatggagcctatagaggtg
cctcttgaggaaaatagtgaacggactcagattcgccaaagcagggtctgtgctgacaga
gtaagtacttatgattgtggagaaaaaatttcaagctggttgtcaacattttttggccgt
ccttgtcatttgatcaaacaaagttcaaactctcaaaggaatgcaaagaagaaacatgga
aaagatcaacttcctggtacaatggccaccctttctctggtgaatgaggcacagtatctg
ctgatcaacacatccagtattttggaacttcaccggcaactaaacaccagtgatgagaat
ggaaaggaggaattattctcactgaaggatctcagcttgcgttttcgtgccaatattatt
atcaatggaaaaagggcttttgaagaagagaaatgggatgagatttcaattggctctttg
cgtttccaggttttggggccttgtcacagatgccagatgatttgcatcgaccagcaaact
gggcaacgaaaccagcatgttttccaaaaactttctgagagtcgtgaaacaaaggtgaac
tttggcatgtacctgatgcatgcatcattggatttatcctccccatgtttcctgtctgta
ggatctcaggtgctccctgtgttgaaagagaatgtggaaggtcatgatttacctgcatct
gagaaacaccaggatgttacctcctaa

DBGET integrated database retrieval system