KEGG   Homo sapiens (human): 55247
Entry
55247             CDS       T01001                                 
Symbol
NEIL3, FGP2, FPG2, NEI3, ZGRF3, hFPG2, hNEI3
Name
(RefSeq) nei like DNA glycosylase 3
  KO
K10569  endonuclease VIII-like 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Network
nt06504  Base excision repair
  Element
N01435  Base excision and strand cleavage by NEIL glycosylase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    55247 (NEIL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    55247 (NEIL3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     55247 (NEIL3)
SSDB
Motif
Pfam: zf-GRF H2TH zf-RanBP Fapy_DNA_glyco
Other DBs
NCBI-GeneID: 55247
NCBI-ProteinID: NP_060718
OMIM: 608934
HGNC: 24573
Ensembl: ENSG00000109674
Pharos: Q8TAT5(Tbio)
UniProt: Q8TAT5
Structure
LinkDB
Position
4:177309874..177371268
AA seq 605 aa
MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALRSLQGRALRLAASTVVVSPQAAALNNDS
SQNVLSLFNGYVYSGVETLGKELFMYFGPKALRIHFGMKGFIMINPLEYKYKNGASPVLE
VQLTKDLICFFDSSVELRNSMESQQRIRMMKELDVCSPEFSFLRAESEVKKQKGRMLGDV
LMDQNVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQIHHLMKMIRDFSILFYRCRKAGL
ALSKHYKVYKRPNCGQCHCRITVCRFGDNNRMTYFCPHCQKENPQHVDICKLPTRNTIIS
WTSSRVDHVMDSVARKSEEHWTCVVCTLINKPSSKACDACLTSRPIDSVLKSEENSTVFS
HLMKYPCNTFGKPHTEVKINRKTAFGTTTLVLTDFSNKSSTLERKTKQNQILDEEFQNSP
PASVCLNDIQHPSKKTTNDITQPSSKVNISPTISSESKLFSPAHKKPKTAQYSSPELKSC
NPGYSNSELQINMTDGPRTLNPDSPRCSKHNRLCILRVVGKDGENKGRQFYACPLPREAQ
CGFFEWADLSFPFCNHGKRSTMKTVLKIGPNNGKNFFVCPLGKEKQCNFFQWAENGPGIK
IIPGC
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggtggaaggaccaggctgtactctgaatggagagaagattcgcgcgcgggtgctcccg
ggccaggcggtgaccggcgtgcggggaagcgctctgcggagtctgcagggccgcgccttg
cggctcgcagcctccacggttgtggtctccccgcaggctgctgcactgaataatgattcc
agccagaatgtcttgagcctgtttaatggatatgtttacagtggcgtggaaactttgggg
aaggagctctttatgtactttggaccaaaagctttacggattcatttcggaatgaaaggc
ttcatcatgattaatccacttgagtataaatataaaaatggagcttctcctgttttggaa
gtgcagctcaccaaagatttgatttgtttctttgactcatcagtagaactcagaaactca
atggaaagccaacagagaataagaatgatgaaagaattagatgtatgttcacctgaattt
agtttcttgagagcagaaagtgaagttaaaaaacagaaaggccggatgctaggtgatgtg
ctaatggatcagaacgtattgcctggagtagggaacatcatcaaaaatgaagctctcttt
gacagtggtctccacccagctgttaaagtttgtcaattaacagatgaacagatccatcac
ctcatgaaaatgatacgtgatttcagcattctcttttacaggtgccgtaaagcaggactt
gctctctctaaacactataaggtttacaagcgtcctaattgtggtcagtgccactgcaga
ataactgtgtgccgctttggggacaataacagaatgacatatttctgtcctcactgtcaa
aaagaaaatcctcaacatgttgacatatgcaagctaccgactagaaatactataatcagt
tggacatctagcagggtggatcatgttatggactccgtggctcggaagtcggaagagcac
tggacctgtgtggtgtgtactttaatcaataagccctcttctaaggcatgtgatgcttgc
ttgacctcaaggcctattgattcagtgctcaagagtgaagaaaattctactgtctttagc
cacttaatgaagtacccgtgtaatacttttggaaaacctcatacagaagtcaagatcaac
agaaaaactgcatttggaactacaactcttgtcttgactgattttagcaataaatccagt
actttggaaagaaaaacaaagcaaaaccagatactagatgaggagtttcaaaactctcct
cctgctagtgtttgtttgaatgatatacagcacccctccaagaagacaacaaacgatata
actcaaccatccagcaaagtaaacatatcacctacaatcagttcagaatctaaattattt
agtccagcacataaaaaaccgaaaacagcccaatactcatcaccagagcttaaaagctgc
aaccctggatattctaacagtgaacttcaaattaatatgacagatggccctcgtacctta
aatcctgacagccctcgctgcagtaaacacaaccgcctctgcattctccgagttgtgggg
aaggatggggaaaacaagggcaggcagttttatgcctgtcctctacctagagaagcacaa
tgtggattttttgaatgggcagatttgtccttcccattctgcaaccatggcaagcgttcc
accatgaaaacagtattgaagattggacctaacaatggaaagaatttttttgtgtgtcct
cttgggaaggaaaaacaatgcaattttttccagtgggcagaaaatgggccaggaataaaa
attattcctggatgctaa

DBGET integrated database retrieval system