KEGG   Homo sapiens (human): 55696
Entry
55696             CDS       T01001                                 
Symbol
RBM22, Cwc2, ZC3H16, fSAP47
Name
(RefSeq) RNA binding motif protein 22
  KO
K12872  pre-mRNA-splicing factor RBM22/SLT11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    55696 (RBM22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    55696 (RBM22)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    55696 (RBM22)
 Complex C
    55696 (RBM22)
SSDB
Motif
Pfam: RRM_1 zf_CCCH_4 Torus Nup35_RRM_2 RRM_occluded zf-CCCH_2 zf-CCCH RRM_3 zf-CCCH_4 FYVE zf-CCCH_3
Other DBs
NCBI-GeneID: 55696
NCBI-ProteinID: NP_060517
OMIM: 612430
HGNC: 25503
Ensembl: ENSG00000086589
Pharos: Q9NW64(Tbio)
UniProt: Q9NW64
Structure
LinkDB
Position
5:complement(150690792..150701062)
AA seq 420 aa
MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPG
VRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQN
MEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECP
YRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLG
DTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV
KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAV
VNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcgacctctctgggttccaacacctacaacaggcagaactgggaggatgcggacttc
cccattctgtgccagacatgtcttggagaaaacccatatatccgaatgaccaaagaaaag
tatgggaaggaatgcaaaatctgtgccaggccattcacagtgtttcgctggtgccctgga
gtccgcatgcgtttcaagaagactgaagtgtgccaaacctgcagtaaattgaagaatgtc
tgtcagacctgcctcttagacctagagtatggcctgcccatccaggttcgtgacgcagga
ttgtcttttaaagatgacatgccaaagtcagatgtcaacaaagagtactatacacagaat
atggagagagagatttctaactctgatggaacacggccagttggcatgctggggaaagcc
acatctaccagtgacatgctgctcaaactggcccggaccacaccctactacaaaaggaat
cgaccccacatttgctccttctgggtgaaaggagagtgtaagagaggagaggaatgtcca
tacagacatgagaagcctacagatccagatgacccccttgctgatcagaatattaaagac
cgttattacggaatcaatgatcctgtagctgacaagcttctaaagcgggcttcaacaatg
cctcggctggacccaccagaggataaaactatcaccacactatatgttggtggtctaggt
gataccattactgagacagatttaagaaatcatttctaccagttcggagagatccggacg
atcactgttgtgcagagacagcagtgtgctttcatccagtttgccacacggcaggctgca
gaagtggctgctgagaagtcctttaataagttgattgtaaatggccgcagactgaatgtg
aaatggggaagatcccaggcagccagaggaaaagaaaaagagaaagatggaactacagac
tctgggatcaaactagaacctgttccaggattgccaggagctcttcctcctcctcctgca
gcagaagaagaagcctctgccaactacttcaacttgcccccaagtggtcctccagctgtg
gtgaacattgctctgccaccgccccctggcattgctccacccccacccccaggttttggg
ccacacatgttccacccaatgggaccaccccctcctttcatgcgggctccaggaccaatc
cactatccttctcaggaccctcagaggatgggagctcatgctggaaaacacagcagcccc
tag

DBGET integrated database retrieval system