KEGG   Homo sapiens (human): 55714
Entry
55714             CDS       T01001                                 
Symbol
TENM3, MCOPCB9, MCOPS15, ODZ3, TEN3, TNM3, Ten-m3, ten-3
Name
(RefSeq) teneurin transmembrane protein 3
  KO
K24473  teneurin
Organism
hsa  Homo sapiens (human)
Disease
H01027  Microphthalmia
H02170  Microphthalmia, syndromic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    55714 (TENM3)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EGF-like domain-containing proteins
  Other EGF-like domain-containing proteins
   55714 (TENM3)
SSDB
Motif
Pfam: Ten_N Tox-GHH RHS_repeat EGF_2 NHL CarboxypepD_reg CarbopepD_reg_2
Other DBs
NCBI-GeneID: 55714
NCBI-ProteinID: NP_001073946
OMIM: 610083
HGNC: 29944
Ensembl: ENSG00000218336
UniProt: Q9P273 A0A140VJW8
LinkDB
Position
4:181447613..182803024
AA seq 2699 aa
MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYG
NRVKDLVHREADEFTRQGQNFTLRQLGVCEPATRRGLAFCAEMGLPHRGYSISAGSDADT
ENEAVMSPEHAMRLWGRGVKSGRSSCLSSRSNSALTLTDTEHENKSDSENEQPASNQGQS
TLQPLPPSHKQHSAQHHPSITSLNRNSLTNRRNQSPAPPAALPAELQTTPESVQLQDSWV
LGSNVPLESRHFLFKTGTGTTPLFSTATPGYTMASGSVYSPPTRPLPRNTLSRSAFKFKK
SSKYCSWKCTALCAVGVSVLLAILLSYFIAMHLFGLNWQLQQTENDTFENGKVNSDTMPT
NTVSLPSGDNGKLGGFTQENNTIDSGELDIGRRAIQEIPPGIFWRSQLFIDQPQFLKFNI
SLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRSLLETERAGRQARSVSLHEA
GFIQYLDSGIWHLAFYNDGKNAEQVSFNTIVIESVVECPRNCHGNGECVSGTCHCFPGFL
GPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCAC
NSGYKGESCEEADCIDPGCSNHGVCIHGECHCSPGWGGSNCEILKTMCPDQCSGHGTYLQ
ESGSCTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEEGWTGPACNQRACHPRCAEHG
TCKDGKCECSQGWNGEHCTIEGCPGLCNSNGRCTLDQNGWHCVCQPGWRGAGCDVAMETL
CTDSKDNEGDGLIDCMDPDCCLQSSCQNQPYCRGLPDPQDIISQSLQSPSQQAAKSFYDR
ISFLIGSDSTHVIPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFFHYPEYGYTITRQD
GMFDLVANGGASLTLVFERSPFLTQYHTVWIPWNVFYVMDTLVMKKEENDIPSCDLSGFV
RPNPIIVSSPLSTFFRSSPEDSPIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKI
TMTQSIIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVS
VGYEYESCLDLTLWEKRTAILQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFIS
QQPPVVSSIMGNGRRRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPS
GNVTSVLELSSNPAHRYYLATDPVTGDLYVSDTNTRRIYRPKSLTGAKDLTKNAEVVAGT
GEQCLPFDEARCGDGGKAVEATLMSPKGMAVDKNGLIYFVDGTMIRKVDQNGIISTLLGS
NDLTSARPLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDNNVVLQITENRQVRIAAGR
PMHCQVPGVEYPVGKHAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISL
VAGIPSECDCKNDANCDCYQSGDGYAKDAKLSAPSSLAASPDGTLYIADLGNIRIRAVSK
NKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSYSNDNDITAVTDSN
GNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLATK
SDETGWTTFFDYDSEGRLTNVTFPTGVVTNLHGDMDKAITVDIESSSREEDVSITSNLSS
IDSFYTMVQDQLRNSYQIGYDGSLRIIYASGLDSHYQTEPHVLAGTANPTVAKRNMTLPG
ENGQNLVEWRFRKEQAQGKVNVFGRKLRVNGRNLLSVDFDRTTKTEKIYDDHRKFLLRIA
YDTSGHPTLWLPSSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDGQGRIVSRVFADGKTW
SYTYLEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNPPES
NASIITDYNEEGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDETAGVLKTV
NLQSDGFICTIRYRQIGPLIDRQIFRFSEDGMVNARFDYSYDNSFRVTSMQGVINETPLP
IDLYQFDDISGKVEQFGKFGVIYYDINQIISTAVMTYTKHFDAHGRIKEIQYEIFRSLMY
WITIQYDNMGRVTKREIKIGPFANTTKYAYEYDVDGQLQTVYLNEKIMWRYNYDLNGNLH
LLNPSNSARLTPLRYDLRDRITRLGDVQYRLDEDGFLRQRGTEIFEYSSKGLLTRVYSKG
SGWTVIYRYDGLGRRVSSKTSLGQHLQFFYADLTYPTRITHVYNHSSSEITSLYYDLQGH
LFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNIDFQLVIGFHG
GLYDPLTKLIHFGERDYDILAGRWTTPDIEIWKRIGKDPAPFNLYMFRNNNPASKIHDVK
DYITDVNSWLVTFGFHLHNAIPGFPVPKFDLTEPSYELVKSQQWDDIPPIFGVQQQVARQ
AKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLNIANED
CIKVAAVLNNAFYLENLHFTIEGKDTHYFIKTTTPESDLGTLRLTSGRKALENGINVTVS
QSTTVVNGRTRRFADVEMQFGALALHVRYGMTLDEEKARILEQARQRALARAWAREQQRV
RDGEEGARLWTEGEKRQLLSAGKVQGYDGYYVLSVEQYPELADSANNIQFLRQSEIGRR
NT seq 8100 nt   +upstreamnt  +downstreamnt
atggatgtgaaagaacgcaggccttactgctccctgaccaagagcagacgagagaaggaa
cggcgctacacaaattcctccgcagacaatgaggagtgccgggtacccacacagaagtcc
tacagttccagcgagacattgaaagcttttgatcatgattcctcgcggctgctttacggc
aacagagtgaaggatttggttcacagagaagcagacgagttcactagacaaggacagaat
tttaccctaaggcagttaggagtttgtgaaccagcaactcgaagaggactggcattttgt
gcggaaatggggctccctcacagaggttactctatcagtgcagggtcagatgctgatact
gaaaatgaagcagtgatgtccccagagcatgccatgagactttggggcaggggggtcaaa
tcaggccgcagctcctgcctgtcaagtcggtccaactcagccctcaccctgacagatacg
gagcacgaaaacaagtccgacagtgagaatgagcaacctgcaagcaatcaaggccagtct
accctgcagcccttgccgccttcccataagcagcactctgcacagcatcatccatccatc
acttctctcaacagaaactccctgaccaatagaaggaaccagagtccggccccgccggct
gctttgcccgccgagctgcaaaccacacccgagtccgtccagctgcaggacagctgggtc
cttggcagtaatgtaccactggaaagcaggcatttcctattcaaaacaggaacaggtaca
acgccactgttcagtactgcaaccccaggatacacaatggcatctggctctgtttattca
ccacctactcggccactacctagaaacaccctatcaagaagtgcttttaaattcaagaag
tcttcaaagtactgtagctggaaatgcactgcactgtgtgccgtaggggtctcggtgctc
ctggcaatactcctgtcttattttatagcaatgcatctctttggcctcaactggcagcta
cagcagactgaaaatgacacatttgagaatggaaaagtgaattctgataccatgccaaca
aacactgtgtcattaccttctggagacaatggaaaattaggtggatttacgcaagaaaat
aacaccatagattccggagaacttgatattggccgaagagcaattcaagagattcctccc
gggatcttctggagatcacagctcttcattgatcagccacagtttcttaaattcaatatc
tctcttcagaaggatgcattgattggagtatatggccggaaaggcttaccgccttcccat
actcagtatgacttcgtggagctcctggatggcagcaggctgattgccagagagcagcgg
agcctgcttgagacggagagagccgggcggcaggcgagatccgtcagccttcatgaggcc
ggctttatccagtacttggattctggaatctggcatctggctttttataatgatgggaaa
aatgcagagcaggtgtcttttaataccattgttatagagtctgtggtggaatgtccccga
aattgccatggaaatggagaatgcgtttctggaacttgccattgttttccaggatttctg
ggtccggattgttcaagagccgcctgtccagtgttatgtagtggcaacgggcagtactcc
aagggccgctgcctgtgtttcagcggctggaagggcaccgagtgtgatgtgccgactacc
cagtgtattgacccacagtgtgggggtcgtgggatttgtatcatgggctcttgtgcttgc
aactcaggatacaaaggagaaagttgtgaagaagctgactgtatagaccctgggtgttct
aatcatggtgtgtgtatccacggggaatgtcactgcagtccaggatggggaggtagcaat
tgtgaaatactgaagaccatgtgtccagaccagtgctccggccacggaacgtatcttcaa
gaaagtggctcctgcacgtgtgaccctaactggactggcccagactgctcaaacgaaata
tgttctgtggactgtggctcacacggcgtttgcatgggggggacgtgtcgctgtgaagaa
ggctggacgggcccagcctgtaatcagagagcctgccacccccgctgtgccgagcacggg
acctgcaaggatggcaagtgtgaatgcagccagggctggaatggagagcactgcactatc
gagggttgtcctggtctgtgcaacagcaatggaagatgtaccctggaccaaaatggctgg
cattgtgtgtgccagcctggatggagaggagcaggctgtgacgtagccatggagactctt
tgcacagatagcaaggacaatgaaggagatggactcattgactgcatggatcccgattgc
tgcctacagagttcctgccagaatcagccctattgtcggggactgccggatcctcaggac
atcattagccaaagccttcaatcgccttctcagcaagctgccaaatccttttatgatcga
atcagtttccttataggatctgatagcacccatgttatacctggagaaagtcctttcaat
aagagccttgcatctgtcatcagaggccaagtactgactgctgatggaactccacttatt
ggagtaaatgtctcgtttttccattacccagaatatggatatactattacccgccaggac
ggaatgtttgacttggtggcaaatggtggggcctctctaactttggtatttgaacgatcc
ccattcctcactcagtatcatactgtgtggattccatggaatgtcttttatgtgatggat
accctagtcatgaagaaagaagagaatgacattcccagctgtgatctgagtggattcgtg
aggccaaatcccatcattgtgtcatcacctttatccacctttttcagatcttctcctgaa
gacagtcccatcattcccgaaacacaggtactccacgaggaaactacaattccaggaaca
gatttgaaactctcctacttgagttccagagctgcagggtataagtcagttctcaagatc
accatgacccagtctattattccatttaatttaatgaaggttcatcttatggtagctgta
gtaggaagactcttccaaaagtggtttcctgcctcaccaaacttggcctatactttcata
tgggataaaacagatgcatataatcagaaagtctatggtctatctgaagctgttgtgtca
gttggatatgagtatgagtcgtgtttggacctgactctgtgggaaaagaggactgccatt
ctgcagggctatgaattggatgcgtccaacatgggtggctggacattagataaacatcac
gtgctggatgtacagaacggtatactgtacaagggaaacggggaaaaccagttcatctcc
cagcagcctccagtcgtgagtagcatcatgggcaatgggcgaaggcgcagcatttcctgc
cccagttgcaatggtcaagctgatggtaacaagttactggccccagtggcgctagcttgt
gggatcgatggcagtctgtacgtaggcgatttcaactatgtgcggcggatattcccttct
ggaaatgtaacaagtgtcttagaactaagcagcaacccagctcatagatactaccttgca
acggatccagtcacgggagatctgtacgtttctgacacaaacacccgcagaatttatcgc
ccaaagtcacttacgggggcaaaagacttgactaaaaatgcagaagtcgtcgcagggaca
ggggagcaatgccttccgtttgacgaggcgagatgtggggatggagggaaggccgtggaa
gccacactcatgagtcccaaaggaatggcagttgataagaatggattaatctactttgtt
gatggaaccatgattaggaaagttgaccaaaatggaatcatatcaactcttctgggctct
aacgatttgacttcagccagacctttaacttgtgacaccagcatgcacatcagccaggta
cgtctggaatggcccactgacctagccattaaccctatggataactccatttatgtcctg
gataataatgtagttttacagatcactgaaaatcgtcaagttcgcattgctgctggacgg
cccatgcactgtcaggttcccggagtggaatatcctgtggggaagcacgcggtgcagaca
acactggaatcagccactgccattgctgtgtcctacagtggggtcctgtacattactgaa
actgatgagaagaaaattaaccggataaggcaggtcacaacagatggagaaatctcctta
gtggccggaataccttcagagtgtgactgcaaaaatgatgccaactgtgactgttaccag
agtggagatggctacgccaaggatgccaaactcagtgccccatcctccctggctgcttct
ccagatggtacactgtatattgcagatctagggaatatccggatccgggctgtgtcaaag
aataagcctttacttaactctatgaacttctatgaagttgcgtctccaactgatcaagaa
ctctacatctttgacatcaatggtactcaccaatatactgtaagtttagtcactggtgat
tacctttacaattttagctacagcaatgacaatgatattactgctgtgacagacagcaat
ggcaacacccttagaattagacgggacccaaatcgcatgccagttcgagtggtgtctcct
gataaccaagtgatatggttgacaataggaacaaatggatgtttgaaaagcatgactgct
caaggactggaattagttttgtttacttaccatggcaatagtggccttttagccactaaa
agtgatgaaactggatggacaacgttttttgactatgacagtgaaggtcgtctgacaaat
gttacgtttccaactggagtggtcacaaacctgcatggggacatggacaaggctatcaca
gtggacattgagtcatctagccgagaagaagatgtcagcatcacttcaaatctgtcctcg
atcgattctttctacaccatggttcaagatcagttaagaaacagctaccagattggttat
gacggctccctcagaattatctacgccagtggcctggactcacactaccaaacagagccg
cacgttctggctggcaccgctaatccgacggttgccaaaagaaacatgactttgcctggc
gagaacggtcaaaacttggtggaatggagattccgaaaagagcaagcccaagggaaagtc
aatgtctttggccgcaagctcagggttaatggcagaaacctcctttcagttgactttgat
cgaacaacaaagacagaaaagatctatgacgaccaccgtaaatttctactgaggatcgcc
tacgacacgtctgggcacccgactctctggctgccaagcagcaagctgatggccgtcaat
gtcacctattcatccacaggtcaaattgccagcatccagcgaggcaccactagcgagaaa
gtagattatgacggacaggggaggatcgtgtctcgggtctttgctgatggtaaaacatgg
agttacacatatttagaaaagtccatggttcttctgcttcatagccagcggcagtacatc
ttcgaatacgatatgtgggaccgcctgtctgccatcaccatgcccagtgtggctcgccac
accatgcagaccatccgatccattggctactaccgcaacatatacaaccccccggaaagc
aacgcctccatcatcacggactacaacgaggaagggctgcttctacaaacagctttcttg
ggtacaagtcggagggtcttattcaaatacagaaggcagactaggctctcagaaatttta
tatgatagcacaagagtcagttttacctatgatgaaacagcaggagtcctaaagacagta
aacctccagagtgatggttttatttgcaccattagatacaggcaaattggtcccctgatt
gacaggcagattttccgctttagtgaagatgggatggtaaatgcaagatttgactatagc
tatgacaacagctttcgagtgaccagcatgcagggtgtgatcaatgaaacgccactgcct
attgatctgtatcagtttgatgacatttctggcaaagttgagcagtttggaaagtttgga
gttatatattatgatattaaccagatcatttctacagctgtaatgacctatacgaagcac
tttgatgctcatggccgtatcaaggagattcaatatgagatattcaggtcgctcatgtac
tggattacaattcagtatgataacatgggtcgggtaaccaagagagagattaaaataggg
ccctttgccaacaccaccaaatatgcttatgaatatgatgttgatggacagctccaaaca
gtttacctcaatgaaaagataatgtggcggtacaactacgatctgaatggaaacctccat
ttactgaacccaagtaacagtgcgcgtctgacaccccttcgctatgacctgcgagacaga
atcactcgactgggtgatgttcaatatcggttggatgaagatggtttcctacgtcaaagg
ggcacggaaatctttgaatatagctccaaggggcttctaactcgagtttacagtaaaggc
agtggctggacagtgatctaccgttatgacggcctgggaaggcgtgtttctagcaaaacc
agtctaggacagcacctgcagtttttttatgctgacttaacttatcccactaggattact
catgtctacaaccattcgagttcagaaattacctccctgtattatgatctccaaggacat
ctttttgccatggaaatcagcagtggggatgaattctatattgcatcggataacacaggg
acaccactggctgtgttcagtagcaatgggcttatgctgaaacagattcagtacactgca
tatggggaaatctattttgactctaatattgactttcaactggtaattggatttcatggt
ggcctgtatgacccactcaccaaattaatccactttggagaaagagattatgacattttg
gcaggacggtggacaacacctgacatagaaatctggaaaagaattgggaaggacccagct
ccttttaacttgtacatgtttaggaataacaaccctgcaagcaaaatccatgacgtgaaa
gattacatcacagatgttaacagctggctggtgacatttggtttccatctgcacaatgct
attcctggattccctgttcccaaatttgatttaacagaaccttcttacgaacttgtgaag
agtcagcagtgggatgatataccgcccatcttcggagtccagcagcaagtggcgcggcag
gccaaggccttcctgtcgctggggaagatggccgaggtgcaggtgagccggcgccgggcc
ggcggcgcgcagtcctggctgtggttcgccacggtcaagtcgctgatcggcaagggcgtc
atgctggccgtcagccagggccgcgtgcagaccaacgtgctcaacatcgccaacgaggac
tgcatcaaggtggcggccgtgctcaacaacgccttctacctggagaacctgcacttcacc
atcgagggcaaggacacgcactacttcatcaagaccaccacgcccgagagcgacctgggc
acgctgcggttgaccagcggccgcaaggcgctggagaacggcatcaacgtgacggtgtcg
cagtccaccacggtggtgaacggcaggacgcgcaggttcgcggacgtggagatgcagttc
ggcgcgctggcgctgcacgtgcgctacggcatgaccctggacgaggagaaggcgcgcatc
ctggagcaggcgcggcagcgcgcgctcgcccgggcctgggcgcgcgagcagcagcgcgtg
cgcgacggcgaggagggcgcgcgcctctggacggagggcgagaagcggcagctgctgagc
gccggcaaggtgcagggctacgacgggtactacgtactctcggtggagcagtaccccgag
ctggccgacagcgccaacaacatccagttcctgcggcagagcgagatcggcaggaggtaa

DBGET integrated database retrieval system