KEGG   Homo sapiens (human): 55916
Entry
55916             CDS       T01001                                 
Symbol
NXT2, P15-2
Name
(RefSeq) nuclear transport factor 2 like export factor 2
  KO
K14285  NTF2-related export protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    55916 (NXT2)
   03015 mRNA surveillance pathway
    55916 (NXT2)
   03008 Ribosome biogenesis in eukaryotes
    55916 (NXT2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    55916 (NXT2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    55916 (NXT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    55916 (NXT2)
   03009 Ribosome biogenesis [BR:hsa03009]
    55916 (NXT2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     55916 (NXT2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    55916 (NXT2)
SSDB
Motif
Pfam: NTF2 SnoaL_2
Other DBs
NCBI-GeneID: 55916
NCBI-ProteinID: NP_001229546
OMIM: 300320
HGNC: 18151
Ensembl: ENSG00000101888
Vega: OTTHUMG00000022185
Pharos: Q9NPJ8(Tdark)
UniProt: Q9NPJ8
LinkDB
Position
X:109535824..109544698
AA seq 142 aa
MATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALN
NFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQS
TPNNTVWKIASDCFRFQDWSSS
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccacgtctctggattttaaaacttatgtagatcaggcatgtagagctgctgaggag
tttgtcaatatttactatgagacaatggataaaagaagacgggcactaaccaggctgtat
ctggacaaggccaccttaatatggaatggaaatgctgtttcagggctggatgccctaaat
aatttttttgacacattgccttctagtgagttccaggtcaatatgttagattgccaacca
gttcatgagcaagcaactcagtcccaaactacagttcttgttgtgaccagtggaactgtg
aagtttgatggaaacaaacaacatttcttcaaccagaacttcctgctgactgctcagtcc
actcccaacaatactgtgtggaagattgcaagtgattgcttccgttttcaagattggtct
agtagttaa

DBGET integrated database retrieval system