KEGG   Homo sapiens (human): 56649
Entry
56649             CDS       T01001                                 
Symbol
TMPRSS4, CAP2, CAPH2, MT-SP2, TMPRSS3
Name
(RefSeq) transmembrane serine protease 4
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    56649 (TMPRSS4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    56649 (TMPRSS4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     56649 (TMPRSS4)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   56649 (TMPRSS4)
SSDB
Motif
Pfam: Trypsin SRCR_2 Trypsin_2 DUF1986 Ldl_recept_a Hepsin-SRCR SRCR
Other DBs
NCBI-GeneID: 56649
NCBI-ProteinID: NP_063947
OMIM: 606565
HGNC: 11878
Ensembl: ENSG00000137648
Vega: OTTHUMG00000164122
Pharos: Q9NRS4(Tbio)
UniProt: Q9NRS4
LinkDB
Position
11:118077078..118125505
AA seq 437 aa
MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKY
YFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSAT
GNWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSS
GPCLSGSLVSLHCLACGKSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWV
LTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDNDIALMKLQFPL
TFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADD
AYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYT
KVSAYLNWIYNVWKAEL
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgttacaggatcctgacagtgatcaacctctgaacagcctcgatgtcaaacccctgcgc
aaaccccgtatccccatggagaccttcagaaaggtggggatccccatcatcatagcacta
ctgagcctggcgagtatcatcattgtggttgtcctcatcaaggtgattctggataaatac
tacttcctctgcgggcagcctctccacttcatcccgaggaagcagctgtgtgacggagag
ctggactgtcccttgggggaggacgaggagcactgtgtcaagagcttccccgaagggcct
gcagtggcagtccgcctctccaaggaccgatccacactgcaggtgctggactcggccaca
gggaactggttctctgcctgtttcgacaacttcacagaagctctcgctgagacagcctgt
aggcagatgggctacagcagcaaacccactttcagagctgtggagattggcccagaccag
gatctggatgttgttgaaatcacagaaaacagccaggagcttcgcatgcggaactcaagt
gggccctgtctctcaggctccctggtctccctgcactgtcttgcctgtgggaagagcctg
aagaccccccgtgtggtgggtgtggaggaggcctctgtggattcttggccttggcaggtc
agcatccagtacgacaaacagcacgtctgtggagggagcatcctggacccccactgggtc
ctcacggcagcccactgcttcaggaaacataccgatgtgttcaactggaaggtgcgggca
ggctcagacaaactgggcagcttcccatccctggctgtggccaagatcatcatcattgaa
ttcaaccccatgtaccccaaagacaatgacatcgccctcatgaagctgcagttcccactc
actttctcaggcacagtcaggcccatctgtctgcccttctttgatgaggagctcactcca
gccaccccactctggatcattggatggggctttacgaagcagaatggagggaagatgtct
gacatactgctgcaggcgtcagtccaggtcattgacagcacacggtgcaatgcagacgat
gcgtaccagggggaagtcaccgagaagatgatgtgtgcaggcatcccggaagggggtgtg
gacacctgccagggtgacagtggtgggcccctgatgtaccaatctgaccagtggcatgtg
gtgggcatcgttagttggggctatggctgcgggggcccgagcaccccaggagtatacacc
aaggtctcagcctatctcaactggatctacaatgtctggaaggctgagctgtaa

KEGG   Homo sapiens (human): 7113
Entry
7113              CDS       T01001                                 
Symbol
TMPRSS2, PRSS10
Name
(RefSeq) transmembrane serine protease 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
hsa05171  Coronavirus disease - COVID-19
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    7113 (TMPRSS2)
  09162 Cancer: specific types
   05215 Prostate cancer
    7113 (TMPRSS2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    7113 (TMPRSS2)
   05164 Influenza A
    7113 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7113 (TMPRSS2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     7113 (TMPRSS2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   7113 (TMPRSS2)
SSDB
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR SRCR Trypsin_2 Ldl_recept_a
Other DBs
NCBI-GeneID: 7113
NCBI-ProteinID: NP_005647
OMIM: 602060
HGNC: 11876
Ensembl: ENSG00000184012
Vega: OTTHUMG00000086762
Pharos: O15393(Tchem)
UniProt: O15393
Structure
LinkDB
Position
21:complement(41464305..41508158)
AA seq 492 aa
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQA
SNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIEC
DSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLR
CIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLI
TPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVF
TDWIYRQMRADG
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggctttgaactcagggtcaccaccagctattggaccttactatgaaaaccatggatac
caaccggaaaacccctatcccgcacagcccactgtggtccccactgtctacgaggtgcat
ccggctcagtactacccgtcccccgtgccccagtacgccccgagggtcctgacgcaggct
tccaaccccgtcgtctgcacgcagcccaaatccccatccgggacagtgtgcacctcaaag
actaagaaagcactgtgcatcaccttgaccctggggaccttcctcgtgggagctgcgctg
gccgctggcctactctggaagttcatgggcagcaagtgctccaactctgggatagagtgc
gactcctcaggtacctgcatcaacccctctaactggtgtgatggcgtgtcacactgcccc
ggcggggaggacgagaatcggtgtgttcgcctctacggaccaaacttcatccttcaggtg
tactcatctcagaggaagtcctggcaccctgtgtgccaagacgactggaacgagaactac
gggcgggcggcctgcagggacatgggctataagaataatttttactctagccaaggaata
gtggatgacagcggatccaccagctttatgaaactgaacacaagtgccggcaatgtcgat
atctataaaaaactgtaccacagtgatgcctgttcttcaaaagcagtggtttctttacgc
tgtatagcctgcggggtcaacttgaactcaagccgccagagcaggattgtgggcggcgag
agcgcgctcccgggggcctggccctggcaggtcagcctgcacgtccagaacgtccacgtg
tgcggaggctccatcatcacccccgagtggatcgtgacagccgcccactgcgtggaaaaa
cctcttaacaatccatggcattggacggcatttgcggggattttgagacaatctttcatg
ttctatggagccggataccaagtagaaaaagtgatttctcatccaaattatgactccaag
accaagaacaatgacattgcgctgatgaagctgcagaagcctctgactttcaacgaccta
gtgaaaccagtgtgtctgcccaacccaggcatgatgctgcagccagaacagctctgctgg
atttccgggtggggggccaccgaggagaaagggaagacctcagaagtgctgaacgctgcc
aaggtgcttctcattgagacacagagatgcaacagcagatatgtctatgacaacctgatc
acaccagccatgatctgtgccggcttcctgcaggggaacgtcgattcttgccagggtgac
agtggagggcctctggtcacttcgaagaacaatatctggtggctgataggggatacaagc
tggggttctggctgtgccaaagcttacagaccaggagtgtacgggaatgtgatggtattc
acggactggatttatcgacaaatgagggcagacggctaa

DBGET integrated database retrieval system