KEGG   Homo sapiens (human): 57104
Entry
57104             CDS       T01001                                 

Gene name
PNPLA2, 1110001C14Rik, ATGL, FP17548, PEDF-R, TTS-2.2, TTS2, iPLA2zeta
Definition
(RefSeq) patatin like phospholipase domain containing 2
  KO
K16816  patatin-like phospholipase domain-containing protein 2 [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04923  Regulation of lipolysis in adipocytes
Module
hsa_M00098  Acylglycerol degradation
Disease
H01297  Neutral lipid storage disease with myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    57104 (PNPLA2)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    57104 (PNPLA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    57104 (PNPLA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     57104 (PNPLA2)
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-GeneID: 57104
NCBI-ProteinID: NP_065109
OMIM: 609059
HGNC: 30802
Ensembl: ENSG00000177666
Vega: OTTHUMG00000133309
Pharos: Q96AD5(Tbio)
UniProt: Q96AD5
LinkDB
Position
11p15.5
AA seq 504 aa
MFPREKTWNISFAGCGFLGVYYVGVASCLREHAPFLVANATHIYGASAGALTATALVTGV
CLGEAGAKFIEVSKEARKRFLGPLHPSFNLVKIIRSFLLKVLPADSHEHASGRLGISLTR
VSDGENVIISHFNSKDELIQANVCSGFIPVYCGLIPPSLQGVRYVDGGISDNLPLYELKN
TITVSPFSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQ
GYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPGEDHILEHL
PARLNEALLEACVEPTDLLTTLSNMLPVRLATAMMVPYTLPLESALSFTIRLLEWLPDVP
EDIRWMKEQTGSICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALP
GWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRAPADPAPAPADPASPQHQ
LAGPAPLLSTPAPEARPVIGALGL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgtttccccgcgagaagacgtggaacatctcgttcgcgggctgcggcttcctcggcgtc
tactacgtcggcgtggcctcctgcctccgcgagcacgcgcccttcctggtggccaacgcc
acgcacatctacggcgcctcggccggggcgctcacggccacggcgctggtcaccggggtc
tgcctgggtgaggctggtgccaagttcattgaggtatctaaagaggcccggaagcggttc
ctgggccccctgcacccctccttcaacctggtaaagatcatccgcagtttcctgctgaag
gtcctgcctgctgatagccatgagcatgccagtgggcgcctgggcatctccctgacccgc
gtgtcagacggcgagaatgtcattatatcccacttcaactccaaggacgagctcatccag
gccaatgtctgcagcggtttcatccccgtgtactgtgggctcatccctccctccctccag
ggggtgcgctacgtggatggtggcatttcagacaacctgccactctatgagcttaagaac
accatcacagtgtcccccttctcgggcgagagtgacatctgtccgcaggacagctccacc
aacatccacgagctgcgggtcaccaacaccagcatccagttcaacctgcgcaacctctac
cgcctctccaaggccctcttcccgccggagcccctggtgctgcgagagatgtgcaagcag
ggataccgggatggcctgcgctttctgcagcggaacggcctcctgaaccggcccaacccc
ttgctggcgttgccccccgcccgcccccacggcccagaggacaaggaccaggcagtggag
agcgcccaagcggaggattactcgcagctgcccggagaagatcacatcctggagcacctg
cccgcccggctcaatgaggccctgctggaggcctgcgtggagcccacggacctgctgacc
accctctccaacatgctgcctgtgcgtctggccacggccatgatggtgccctacacgctg
ccgctggagagcgctctgtccttcaccatccgcttgctggagtggctgcccgacgttccc
gaggacatccggtggatgaaggagcagacgggcagcatctgccagtacctggtgatgcgc
gccaagaggaagctgggcaggcacctgccctccaggctgccggagcaggtggagctgcgc
cgcgtccagtcgctgccgtccgtgccgctgtcctgcgccgcctacagagaggcactgccc
ggctggatgcgcaacaacctctcgctgggggacgcgctggccaagtgggaggagtgccag
cgccagctgctgctcggcctcttctgcaccaacgtggccttcccgcccgaagctctgcgc
atgcgcgcacccgccgacccggctcccgcccccgcggacccagcatccccgcagcaccag
ctggccgggcctgcccccttgctgagcacccctgctcccgaggcccggcccgtgatcggg
gccctggggctgtga

DBGET integrated database retrieval system