KEGG   Homo sapiens (human): 57169
Entry
57169             CDS       T01001                                 
Symbol
ZNFX1, IMD91
Name
(RefSeq) zinc finger NFX1-type containing 1
  KO
K27391  NFX1-type zinc finger-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
Network
nt06171  SARS coronavirus 2 (SARS-CoV-2)
nt06519  RLR signaling
  Element
N01308  MDA5-IRF7/3 signaling pathway
Disease
H02525  Disorders of innate immunity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    57169 (ZNFX1)
SSDB
Motif
Pfam: AAA_12 AAA_11 ZnF_RZ-type AAA_19 AAA_30 ResIII SLFN-g3_helicase PhoH DEAD LON_substr_bdg nSTAND3 PRT_C AAA
Other DBs
NCBI-GeneID: 57169
NCBI-ProteinID: NP_066363
OMIM: 618931
HGNC: 29271
Ensembl: ENSG00000124201
UniProt: Q9P2E3
LinkDB
Position
20:complement(49245900..49278057)
AA seq 1918 aa
MEERRPHLDARPRNSHTNHRGPVDGELPPRARNQANNPPANALRGGASHPGRHPRANNHP
AAYWQREERFRAMGRNPHQGRRNQEGHASDEARDQRHDQENDTRWRNGNQDCRNRRPPWS
NDNFQQWRTPHQKPTEQPQQAKKLGYKFLESLLQKDPSEVVITLATSLGLKELLSHSSMK
SNFLELICQVLRKACSSKMDRQSVLHVLGILKNSKFLKVCLPAYVVGMITEPIPDIRNQY
PEHISNIISLLQDLVSVFPASSVQETSMLVSLLPTSLNALRASGVDIEEETEKNLEKVQT
IIEHLQEKRREGTLRVDTYTLVQPEAEDHVESYRTMPIYPTYNEVHLDERPFLRPNIISG
KYDSTAIYLDTHFRLLREDFVRPLREGILELLQSFEDQGLRKRKFDDIRIYFDTRIITPM
CSSSGIVYKVQFDTKPLKFVRWQNSKRLLYGSLVCMSKDNFETFLFATVSNREQEDLCRG
IVQLCFNEQSQQLLAEVQPSDSFLMVETTAYFEAYRHVLEGLQEVQEEDVPFQRNIVECN
SHVKEPRYLLMGGRYDFTPLIENPSATGEFLRNVEGLRHPRINVLDPGQWPSKEALKLDD
SQMEALQFALTRELAIIQGPPGTGKTYVGLKIVQALLTNESVWQISLQKFPILVVCYTNH
ALDQFLEGIYNCQKTSIVRVGGRSNSEILKQFTLRELRNKREFRRNLPMHLRRAYMSIMT
QMKESEQELHEGAKTLECTMRGVLREQYLQKYISPQHWESLMNGPVQDSEWICFQHWKHS
MMLEWLGLGVGSFTQSVSPAGPENTAQAEGDEEEEGEEESSLIEIAEEADLIQADRVIEE
EEVVRPQRRKKEESGADQELAKMLLAMRLDHCGTGTAAGQEQATGEWQTQRNQKKKMKKR
VKDELRKLNTMTAAEANEIEDVWQLDLSSRWQLYRLWLQLYQADTRRKILSYERQYRTSA
ERMAELRLQEDLHILKDAQVVGMTTTGAAKYRQILQKVEPRIVIVEEAAEVLEAHTIATL
SKACQHLILIGDHQQLRPSANVYDLAKNFNLEVSLFERLVKVNIPFVRLNYQHRMCPEIA
RLLTPHIYQDLENHPSVLKYEKIKGVSSNLFFVEHNFPEQEIQEGKSHQNQHEAHFVVEL
CKYFLCQEYLPSQITILTTYTGQLFCLRKLMPAKTFAGVRVHVVDKYQGEENDIILLSLV
RSNQEGKVGFLQISNRICVALSRAKKGMYCIGNMQMLAKVPLWSKIIHTLRENNQIGPML
RLCCQNHPETHTLVSKASDFQKVPEGGCSLPCEFRLGCGHVCTRACHPYDSSHKEFQCMK
PCQKVICQEGHRCPLVCFQECQPCQVKVPKTIPRCGHEQMVPCSVPESDFCCQEPCSKSL
RCGHRCSHPCGEDCVQLCSEMVTIKLKCGHSQPVKCGHVEGLLYGGLLVKCTTKCGTILD
CGHPCPGSCHSCFEGRFHERCQQPCKRLLICSHKCQEPCIGECPPCQRTCQNRCVHSQCK
KKCGELCSPCVEPCVWRCQHYQCTKLCSEPCNRPPCYVPCTKLLVCGHPCIGLCGEPCPK
KCRICHMDEVTQIFFGFEDEPDARFVQLEDCSHIFEVQALDRYMNEQKDDEVAIRLKVCP
ICQVPIRKNLRYGTSIKQRLEEIEIIKEKIQGSAGEIATSQERLKALLERKSLLHQLLPE
DFLMLKEKLAQKNLSVKDLGLVENYISFYDHLASLWDSLKKMHVLEEKRVRTRLEQVHEW
LAKKRLSFTSQELSDLRSEIQRLTYLVNLLTRYKIAEKKVKDSIAVEVYSVQNILEKTCK
FTQEDEQLVQEKMEALKATLPCSGLGISEEERVQIVSAIGYPRGHWFKCRNGHIYVIGDC
GGAMERGTCPDCKEVIGGTNHTLERSNQLASEMDGAQHAAWSDTANNLMNFEEIQGMM
NT seq 5757 nt   +upstreamnt  +downstreamnt
atggaggagagaagacctcatctggatgccaggcccaggaattcccataccaaccacaga
ggccctgtggatggagagttaccaccaagagctagaaatcaggccaataacccaccagcc
aatgctctccgaggaggagccagccaccctggaaggcatcctagggccaacaaccatcct
gctgcttactggcagagggaagagagatttagggccatgggcaggaacccacatcaagga
aggaggaaccaggaggggcatgccagcgacgaagctagagaccaaagacatgaccaggag
aatgacaccaggtggagaaatggcaaccaggactgtaggaaccgcagaccaccatggtcc
aatgacaacttccagcagtggcggactccccaccagaagcctacagaacagccacagcag
gcgaagaaactgggctacaagttcttagaaagtcttctgcagaaagacccttctgaggtg
gtcatcacacttgccacaagtttagggctgaaagagctcctttctcattcttccatgaaa
tctaacttccttgagctcatctgtcaggttcttcggaaggcttgtagctccaaaatggat
cgccagagtgttctccatgtactgggcatattgaaaaactccaaatttctcaaagtctgc
ctgcctgcttatgtggtagggatgatcactgaacccatccctgacatccgaaaccagtat
ccagagcacataagcaacatcatctccctcctccaggaccttgtaagtgtcttccctgcc
agctctgtgcaggaaacttccatgctggtttccctcctgccaacctctcttaatgctctg
agagcctctggtgttgacatagaagaggaaacggagaagaacctggaaaaggtacagact
atcattgaacatctgcaggaaaagaggcgagagggcactttgagagtggatacctacact
ctagtgcagcctgaggcagaagaccatgttgagagctaccgaaccatgcccatttaccct
acctacaatgaagtgcacttggatgagaggcccttccttcgccccaatatcatttctgga
aaatacgacagcactgctatctatctggatacccacttccggctcctgcgagaagatttc
gtcagacctttacgggaaggtattttggaacttctccaaagctttgaagaccagggcctg
aggaagagaaagtttgatgacatccgaatctactttgacaccaggattatcacccccatg
tgttcatcatcaggcatagtctacaaggtgcagtttgacacaaaaccactgaagtttgtt
cgctggcagaattccaaacgattgctctatgggtctttggtatgcatgtccaaggacaac
ttcgagacatttctttttgccaccgtatctaacagggagcaggaagatctctgccgagga
attgtccagctctgcttcaatgagcaaagccaacagctgctagcagaggtccagccctct
gactctttcctcatggtagagacaactgcatactttgaggcctacaggcacgtcctggaa
ggactccaggaggtccaggaggaagatgttcccttccagaggaatatcgtggagtgtaac
tctcatgtgaaggagccaaggtacttgctaatggggggcagatacgactttaccccctta
atagagaatccttcagccactggggaatttctaagaaatgtcgagggtttgagacatccc
agaattaatgtcttagatcctggccagtggccctcaaaagaagccctgaagctggatgac
tcccagatggaagccttgcagtttgctctcacaagggaactggctattattcaaggacct
cctggaacaggcaaaacctatgtgggtctaaaaattgttcaggccctcctaaccaacgag
tctgtttggcaaattagcctccagaagttccccatcttggttgtgtgttatactaatcat
gctttggaccagtttctggaaggcatctacaattgtcagaagaccagcattgtgcgggtg
ggtggaaggagcaacagtgaaatcctgaagcagttcaccctaagggagctgaggaacaag
cgggaattccgccgcaacctccccatgcacctccgaagggcctacatgagtatcatgaca
cagatgaaggagtcagagcaagagcttcatgaaggagccaagaccctggagtgcaccatg
cgtggtgtcctacgggaacagtacctgcagaagtacatctcaccccagcactgggaaagt
ctcatgaatggaccagtgcaggatagtgaatggatttgcttccagcactggaagcattcc
atgatgctggagtggctaggtcttggtgtcggttctttcacgcaaagtgtttctccagca
ggacctgagaatacagcccaggcagaaggggatgaggaggaagaaggggaggaggagagt
tcgctgatagagatcgcagaggaagctgacctgattcaagcagaccgggtgattgaggag
gaagaggtggtgaggccccagcggcggaagaaggaagagagtggagcagaccaggagttg
gctaaaatgcttctggccatgaggctagaccattgtggcactgggacagcagctggacag
gagcaagccacaggagagtggcagacccagcgcaaccagaaaaagaaaatgaaaaaaaga
gtgaaggatgagcttcgcaaactgaacaccatgactgcagccgaggccaacgagatcgag
gatgtttggcagctggacctcagttctcgctggcagctttataggctctggctacagttg
taccaggctgacacccgccggaagatcctcagctatgaacgccagtaccgcacatcagca
gaaagaatggccgagctgagactccaggaagacctgcacattcttaaagatgcccaggtt
gtaggaatgacaaccacaggtgctgccaaataccgccagatcctacagaaggtggagccg
aggattgtcatagtggaagaagctgcggaagtccttgaggcccataccattgccacattg
agcaaagcttgccagcacctcattttgattggggaccaccagcagctgcgccccagtgcc
aacgtgtatgatctggccaagaacttcaaccttgaggtgtccctttttgaacggctagtg
aaagtaaacattccctttgtccgtctgaattaccagcaccgtatgtgccctgaaattgcc
cgccttttgaccccccacatttaccaggatctggagaatcatccatctgttcttaagtat
gagaagattaagggggtgtcttccaaccttttctttgtagaacacaactttcctgaacag
gaaatccaagagggcaaaagccatcagaaccagcatgaggctcactttgtggtagagctg
tgcaagtacttcctgtgccaggaatacctgccttcccagatcaccatcctcactacctat
accgggcagctcttctgcctgcgcaaactgatgcctgccaagacatttgctggcgtcagg
gtccatgttgtggacaaataccaaggggaagagaatgacatcatcctcctctcgctagtg
cggagcaaccaagaaggcaaggtgggttttctgcagatatccaaccgcatctgtgtggcc
ttgtcccgagccaagaagggaatgtactgcatcggaaacatgcagatgctggccaaggtg
cccctgtggagcaagatcattcatacacttcgagagaacaatcaaataggccccatgctc
cggctctgctgccagaaccaccctgaaacccacaccttagtatccaaagcttctgacttc
caaaaagtacccgaaggaggctgcagcctgccctgcgagttccgcctgggctgtgggcat
gtctgcacccgtgcctgccacccttatgactcttcacacaaggagttccaatgcatgaag
ccatgccagaaggtcatctgtcaggaagggcaccggtgtccccttgtttgcttccaggag
tgtcagccttgtcaggtgaaggtgcccaaaaccattcctcggtgcggccatgaacaaatg
gtcccttgttccgtgcctgagtcagatttctgctgccaggagccttgctccaagtctctg
agatgtgggcacagatgcagccacccatgtggtgaggactgtgtgcagctgtgttcagaa
atggtcaccataaaactcaagtgtgggcacagtcaaccggtaaaatgtggtcatgtggaa
ggcctcctgtatggtggtctgctagtcaagtgtaccacaaagtgtggcactatcttggac
tgcgggcatccttgcccaggctcctgccacagctgcttcgaagggcgtttccatgaacgc
tgtcagcagccctgcaagcgcctgcttatctgctcacacaagtgccaggaaccatgcatt
ggtgagtgcccaccctgccagcggacctgtcagaaccgctgtgtccacagccagtgcaag
aagaaatgtggggagctgtgtagtccctgcgtggaaccctgtgtctggcgctgccagcac
taccagtgcaccaaactctgctctgagccctgcaaccgacccccatgctatgtgccttgt
actaagctgctagtttgtggccacccctgcattggtctctgtggggagccatgccccaag
aaatgccggatctgccacatggatgaggtcacccaaatattctttggctttgaggatgag
cctgatgcccgctttgtgcagctggaagactgcagccacatctttgaggtgcaagcccta
gaccgctacatgaatgaacagaaggatgatgaagtcgccatcagattgaaagtctgccct
atctgccaggtgcccatccgcaaaaacctgaggtatggaactagcataaaacagcggcta
gaagagattgaaatcatcaaggaaaagatccagggctcagcaggggaaatagcaaccagc
caggaacggcttaaggccctgctggagaggaagagcctcctccaccagctgcttcctgaa
gacttcctgatgttaaaggagaagctggcccagaaaaatctgtcagtgaaggacctgggt
ctggttgagaattacatcagcttctatgaccacctggccagcctgtgggattccctgaaa
aagatgcatgtcttagaagagaaaagagtgaggactcgactagaacaggtccatgagtgg
ctggccaagaagcgcttgagcttcactagccaggaactaagtgacctccgaagtgaaatc
cagaggctcacatacctggtgaaccttctgacccgctacaagatagcagagaagaaggtg
aaagatagcatagcagtagaggtctatagtgtccagaatatccttgagaaaacatgtaag
ttcacccaagaggatgaacaacttgtgcaggaaaagatggaagctctgaaagccaccctt
ccctgctctggcctgggcatctcagaggaagagcgagtgcagattgtcagtgccataggt
tatcctcgtggtcactggttcaagtgccgcaatggccatatctatgtgattggcgattgt
gggggagccatggagaggggcacgtgtcctgactgtaaggaagtgattggtggcacaaat
catactctggaaagaagcaaccagcttgcttctgaaatggatggagcccagcatgctgcc
tggtctgacacggccaacaacctgatgaactttgaggagatccaggggatgatgtag

DBGET integrated database retrieval system