KEGG   Homo sapiens (human): 57697
Entry
57697             CDS       T01001                                 
Symbol
FANCM, FAAP250, KIAA1596, POF15, SPGF28
Name
(RefSeq) FA complementation group M
  KO
K10896  fanconi anemia group M protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Disease
H00238  Fanconi anemia
H00627  Premature ovarian failure
H01282  Spermatogenic failure
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    57697 (FANCM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    57697 (FANCM)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     57697 (FANCM)
SSDB
Motif
Pfam: FANCM-MHF_bd Helicase_C DEAD ResIII ERCC4 HHH_2
Other DBs
NCBI-GeneID: 57697
NCBI-ProteinID: NP_065988
OMIM: 609644
HGNC: 23168
Ensembl: ENSG00000187790
Vega: OTTHUMG00000170807
Pharos: Q8IYD8(Tbio)
UniProt: Q8IYD8
Structure
LinkDB
Position
14:45135930..45200890
AA seq 2048 aa
MSGRQRTLFQTWGSSISRSSGTPGCSSGTERPQSPGSSKAPLPAAAEAQLESDDDVLLVA
AYEAERQLCLENGGFCTSAGALWIYPTNCPVRDYQLHISRAALFCNTLVCLPTGLGKTFI
AAVVMYNFYRWFPSGKVVFMAPTKPLVTQQIEACYQVMGIPQSHMAEMTGSTQASTRKEI
WCSKRVLFLTPQVMVNDLSRGACPAAEIKCLVIDEAHKALGNYAYCQVVRELVKYTNHFR
ILALSATPGSDIKAVQQVITNLLIGQIELRSEDSPDILTYSHERKVEKLIVPLGEELAAI
QKTYIQILESFARSLIQRNVLMRRDIPNLTKYQIILARDQFRKNPSPNIVGIQQGIIEGE
FAICISLYHGYELLQQMGMRSLYFFLCGIMDGTKGMTRSKNELGRNEDFMKLYNHLECMF
ARTRSTSANGISAIQQGDKNKKFVYSHPKLKKLEEVVIEHFKSWNAENTTEKKRDETRVM
IFSSFRDSVQEIAEMLSQHQPIIRVMTFVGHASGKSTKGFTQKEQLEVVKQFRDGGYNTL
VSTCVGEEGLDIGEVDLIICFDSQKSPIRLVQRMGRTGRKRQGRIVIILSEGREERIYNQ
SQSNKRSIYKAISSNRQVLHFYQRSPRMVPDGINPKLHKMFITHGVYEPEKPSRNLQRKS
SIFSYRDGMRQSSLKKDWFLSEEEFKLWNRLYRLRDSDEIKEITLPQVQFSSLQNEENKP
AQESTTGIHQLSLSEWRLWQDHPLPTHQVDHSDRCRHFIGLMQMIEGMRHEEGECSYELE
VESYLQMEDVTSTFIAPRNESNNLASDTFITHKKSSFIKNINQGSSSSVIESDEECAEIV
KQTHIKPTKIVSLKKKVSKEIKKDQLKKENNHGIIDSVDNDRNSTVENIFQEDLPNDKRT
SDTDEIAATCTINENVIKEPCVLLTECQFTNKSTSSLAGNVLDSGYNSFNDEKSVSSNLF
LPFEEELYIVRTDDQFYNCHSLTKEVLANVERFLSYSPPPLSGLSDLEYEIAKGTALENL
LFLPCAEHLRSDKCTCLLSHSAVNSQQNLELNSLKCINYPSEKSCLYDIPNDNISDEPSL
CDCDVHKHNQNENLVPNNRVQIHRSPAQNLVGENNHDVDNSDLPVLSTDQDESLLLFEDV
NTEFDDVSLSPLNSKSESLPVSDKTAISETPLVSQFLISDELLLDNNSELQDQITRDANS
FKSRDQRGVQEEKVKNHEDIFDCSRDLFSVTFDLGFCSPDSDDEILEHTSDSNRPLDDLY
GRYLEIKEISDANYVSNQALIPRDHSKNFTSGTVIIPSNEDMQNPNYVHLPLSAAKNEEL
LSPGYSQFSLPVQKKVMSTPLSKSNTLNSFSKIRKEILKTPDSSKEKVNLQRFKEALNST
FDYSEFSLEKSKSSGPMYLHKSCHSVEDGQLLTSNESEDDEIFRRKVKRAKGNVLNSPED
QKNSEVDSPLHAVKKRRFPINRSELSSSDESENFPKPCSQLEDFKVCNGNARRGIKVPKR
QSHLKHVARKFLDDEAELSEEDAEYVSSDENDESENEQDSSLLDFLNDETQLSQAINDSE
MRAIYMKSLRSPMMNNKYKMIHKTHKNINIFSQIPEQDETYLEDSFCVDEEESCKGQSSE
EEVCVDFNLITDDCFANSKKYKTRRAVMLKEMMEQNCAHSKKKLSRIILPDDSSEEENNV
NDKRESNIAVNPSTVKKNKQQDHCLNSVPSGSSAQSKVRSTPRVNPLAKQSKQTSLNLKD
TISEVSDFKPQNHNEVQSTTPPFTTVDSQKDCRKFPVPQKDGSALEDSSTSGASCSKSRP
HLAGTHTSLRLPQEGKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNR
MVVERRSQSEMLNSVNKNKFIEQIQHLQSMFERICVIVEKDREKTGDTSRMFRRTKSYDS
LLTTLIGAGIRILFSSCQEETADLLKELSLVEQRKNVGIHVPTVVNSNKSEALQFYLSIP
NISYITALNMCHQFSSVKRMANSSLQEISMYAQVTHQKAEEIYRYIHYVFDIQMLPNDLN
QDRLKSDI
NT seq 6147 nt   +upstreamnt  +downstreamnt
atgagcggacggcaaagaacgctttttcagacgtggggctcaagtatctcccgatcatct
gggactccgggttgcagctccggaactgagcgacctcagagccctggcagctccaaggcg
cctttgccagcagcagcggaggctcagctggagtcggacgatgatgtgttgcttgtcgcg
gcgtacgaggctgagcggcagttgtgtctagagaatggcgggttctgcacctccgcgggc
gccctgtggatttaccctaccaattgcccagtgcgggactaccagctgcacatttcccgg
gctgctctgttttgcaatacgctggtgtgtctgcctaccggactgggaaagacctttatt
gccgccgtggtcatgtacaatttctaccgctggttcccttcaggaaaggtggtcttcatg
gccccaacgaaacccttggtgacacagcagatcgaggcttgctaccaggtgatgggtatc
ccgcaatcccacatggccgaaatgacagggtctacacaagcttccaccaggaaggaaata
tggtgcagtaagagagtgctttttcttacacctcaggtcatggtaaatgacctttctaga
ggagcttgtcccgctgctgaaataaagtgtttagttattgatgaagctcataaagctctc
ggaaactatgcttattgccaggttgtaagagaactagtcaaatatacaaatcactttaga
atcttggctctaagtgccacaccaggtagtgatataaaggctgtgcaacaagttattact
aacctgctaattgggcagatagagcttcgttctgaagattctccagatattttgacatat
tctcatgaaagaaaagttgaaaagcttattgttccgcttggtgaagaacttgcagccatc
caaaagacctatatccagattttggaatcatttgctcgttctttgattcagaggaatgtt
ttgatgagaagggatatcccaaatctaacaaaatatcagataattctggcaagagatcag
tttaggaaaaacccatctccgaatattgtgggaatacaacaaggcataatcgagggagag
tttgctatttgtattagtttatatcatggttatgaattattgcagcaaatgggaatgaga
tcattatatttcttcctttgtggaattatggatggaactaaagggatgacacggtcaaaa
aatgaacttggccgaaatgaagacttcatgaaactctataatcatctagagtgtatgttt
gcacgtacacgtagtacttcagcaaatggtatttctgctatccaacaaggagataaaaat
aaaaaatttgtttatagtcatccaaagttaaagaaattagaagaagttgtaattgaacac
ttcaagtcatggaatgctgaaaacactactgaaaagaaacgtgatgagacccgagttatg
atcttctcttcatttcgagatagtgttcaagaaattgcagaaatgctttcacagcatcag
ccaattattagagtaatgacttttgtcggccatgcctcagggaaaagcacgaagggtttt
acccagaaggagcaactggaggtagtgaaacagtttcgtgacggtggttacaacacgctg
gtttctacctgtgtgggtgaagaaggtttggatataggagaagttgatcttataatatgt
tttgattcccagaagagcccaattcgtcttgtacaacgaatgggtagaactggccgtaaa
cgtcaaggcaggatagttattatcctttctgaaggacgagaggaacgtatttataatcag
agtcagtccaacaaaagaagtatatataaagctatttcaagtaacaggcaggtccttcat
ttttaccaaagaagtccacgaatggttcctgatggaatcaacccaaaattacacaaaatg
ttcatcacacatggtgtctatgaaccagagaagccttctcggaacttgcagcgaaagtca
tctatcttttcctatagggatggaatgaggcaaagtagcctaaagaaagattggttctta
tcagaagaagaatttaaattatggaacagactttatagattaagggacagtgatgaaatt
aaagagataacattgcctcaagttcagttttcttctttacaaaatgaggaaaacaaacca
gctcaagaatcaaccactggaattcatcaactctctctctctgaatggagactgtggcaa
gatcatcctttgcctacacatcaagttgatcactcagatcgatgccgccattttataggc
cttatgcaaatgatagagggaatgagacacgaagagggagaatgcagctatgaattggaa
gttgaatcttatttacaaatggaagatgttacctcaacatttattgctcccaggaatgaa
tctaataatcttgccagtgacacctttatcactcacaagaaatcgtcatttataaagaac
ataaatcaaggcagttcatcctcagtgatagaatctgatgaagaatgtgctgaaattgtt
aaacaaactcatatcaaacctactaaaattgtttctttaaagaaaaaagtgtctaaagaa
ataaaaaaagatcagcttaaaaaagaaaataatcacggtattatagattctgtagataat
gacagaaattccactgttgaaaatatttttcaagaagacctaccaaatgataaaaggaca
tcagatacagatgaaattgctgccacatgtactattaatgaaaatgttattaaagaaccg
tgtgtgttattaacagagtgtcagtttacaaataaatccactagttcacttgctggaaat
gttttagattctggttataacagtttcaatgatgaaaaatctgtttcatctaacttattt
cttccattcgaagaagagctttatattgttagaacagatgaccaattttataattgtcac
tcattgacaaaagaggtactagctaatgtagagagatttttatcttattctcctccgcct
ctcagtggactctcagacttggaatatgaaattgctaagggtactgcacttgagaatttg
cttttcttaccctgtgcagagcatttacgaagtgataaatgcacctgtttgctgtcacat
tcagctgtgaattctcaacagaatttagaattgaattcacttaaatgtataaattatcca
tctgaaaaaagttgcctttatgatatacctaatgataatatttctgatgagccaagtctc
tgtgactgtgatgtacataaacataatcaaaatgaaaatttagtacctaacaatcgtgtt
caaatacacagaagccctgcacagaatttagttggagagaacaatcatgatgttgataac
agtgacctcccagtattgtccactgatcaagatgaaagtttgctgttatttgaagatgtt
aatacagagttcgacgatgtgagtctttcacccttgaacagtaaaagcgaatctttacct
gtgtcagacaaaactgctattagtgaaacgcctctggtctctcagttcttaatttctgat
gaacttttgttggacaataattctgaactccaagatcaaatcacccgtgatgctaatagt
tttaaatctcgtgatcagagaggtgtacaggaagaaaaagtgaagaatcatgaggatatt
tttgattgctctagggatttattttctgttacctttgatttaggattctgtagtccagat
tctgatgatgaaatattggaacatacatcagatagcaatagacctctagatgatctatat
ggaaggtatttggaaattaaggagataagtgatgcaaattatgtttcgaatcaagcacta
ataccaagagatcatagtaaaaattttactagtggaactgttattatcccatcaaatgaa
gatatgcagaatccaaattatgtacatttgccactgagtgcagcaaaaaatgaagaattg
ttatctcctggttattctcagttttctttaccagtgcaaaaaaaagttatgagtacacca
ctctctaaatcaaacacattgaactcattttctaagataagaaaggaaatacttaagaca
ccagattctagtaaggaaaaagtaaacctacaaagattcaaagaagcattgaattcaact
tttgattattcagaattttctctagaaaagtctaaaagcagtggtccaatgtatctgcat
aaatcctgtcattctgttgaagatggacaattattaacaagtaacgaaagtgaagatgac
gagattttccgaagaaaagttaaaagagcaaaaggaaatgttttaaactctcctgaggat
cagaaaaatagtgaagttgattctccacttcatgctgtcaaaaagcgcagatttcctata
aacagatcagaattatcatctagtgatgagagtgagaattttcccaaaccatgttcacaa
ttagaagacttcaaggtttgtaacgggaatgccagaagaggcatcaaagtcccaaagaga
cagagtcacttaaagcatgtagctaggaagtttttagatgatgaagcagaactttctgaa
gaagatgcagaatatgtttcatcagatgaaaatgatgagtcagaaaatgaacaagattcc
tcattacttgactttttaaatgatgaaactcaactttcacaggctataaatgattctgaa
atgagagctatttacatgaaatctttgcgtagtccaatgatgaacaataagtacaaaatg
attcataagacacataaaaacataaacattttctcgcagattcctgaacaagatgaaacc
tatttagaggatagtttttgtgttgatgaagaggagtcttgcaaaggccaatcaagtgaa
gaagaagtttgtgttgattttaacttaataactgatgattgctttgcaaatagtaaaaag
tataaaactcgacgtgcagtaatgctaaaagaaatgatggaacaaaattgtgcacattca
aaaaagaaattatccagaattattttaccagatgattcaagtgaggaggagaacaatgta
aatgataaaagagaatctaatattgcggttaacccaagcactgttaagaagaacaaacaa
caggaccattgtttaaattcagtgccttctggatcttctgcgcagtccaaggtgcgttct
actccaagagttaatccattagcaaagcagagcaaacagacatcgctgaatttaaaggat
acaatttccgaagtctcagacttcaaacctcagaatcataatgaagtccagtctaccaca
ccacccttcactactgttgattcacagaaagactgtagaaaatttccagttccacagaag
gatggtagtgctttggaggattctagcacttcaggggcatcctgttccaagtcaagacca
catttagctgggacacatacttctcttagacttccgcaggaaggaaaaggaacctgtatt
cttgtaggtggtcatgaaatcacttctggattagaagtaatttcttccctaagagcaatt
catgggttgcaagtagaagtttgtcctcttaatggctgtgattacatcgtgagtaatcgc
atggtggtggaaaggaggtctcaatctgagatgttaaatagtgtcaataagaacaagttc
attgagcagatccagcacctgcagagtatgtttgaaagaatatgtgtgattgtggaaaag
gacagagaaaaaacaggagacacatcaaggatgtttaggagaacaaagagctatgacagc
ctgctgactaccttaattggcgctggaatccgaattcttttcagttcctgccaagaagaa
accgcagatttgctaaaggaactgtctttagtggaacaaagaaagaatgttggtattcat
gttccaacagtggtgaatagtaataaaagtgaggcactccagttttatttaagtattccc
aatataagttatataactgcattaaatatgtgtcaccagttttcatctgtgaaaaggatg
gctaacagctcacttcaagaaatctccatgtatgcacaagtaactcatcagaaggctgag
gagatctatagatatattcactatgtatttgacatacaaatgttaccaaatgatcttaac
caagatagactgaaatctgatatataa

DBGET integrated database retrieval system