KEGG   Homo sapiens (human): 586
Entry
586               CDS       T01001                                 
Symbol
BCAT1, BCATC, BCT1, ECA39, MECA39, PNAS121, PP18
Name
(RefSeq) branched chain amino acid transaminase 1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00280  Valine, leucine and isoleucine degradation
hsa00290  Valine, leucine and isoleucine biosynthesis
hsa00770  Pantothenate and CoA biosynthesis
hsa01100  Metabolic pathways
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
hsa01240  Biosynthesis of cofactors
Module
hsa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Network
nt06024  Valine, leucine and isoleucine degradation
  Element
N00832  Branched-chain amino acids degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    586 (BCAT1)
   00280 Valine, leucine and isoleucine degradation
    586 (BCAT1)
   00290 Valine, leucine and isoleucine biosynthesis
    586 (BCAT1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    586 (BCAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    586 (BCAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     586 (BCAT1)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class IV
   586 (BCAT1)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 586
NCBI-ProteinID: NP_005495
OMIM: 113520
HGNC: 976
Ensembl: ENSG00000060982
Vega: OTTHUMG00000169053
Pharos: P54687(Tchem)
UniProt: P54687 A0A024RAV0
Structure
LinkDB
Position
12:complement(24810024..24949101)
AA seq 386 aa
MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTV
EWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRM
YRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTK
ALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDN
GCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQ
WGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPK
LASRILSKLTDIQYGREESDWTIVLS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaaggattgcagtaacggatgctccgcagagtgtaccggagaaggaggatcaaaagag
gtggtggggacttttaaggctaaagacctaatagtcacaccagctaccattttaaaggaa
aaaccagaccccaataatctggtttttggaactgtgttcacggatcatatgctgacggtg
gagtggtcctcagagtttggatgggagaaacctcatatcaagcctcttcagaacctgtca
ttgcaccctggctcatcagctttgcactatgcagtggaattatttgaaggattgaaggca
tttcgaggagtagataataaaattcgactgtttcagccaaacctcaacatggatagaatg
tatcgctctgctgtgagggcaactctgccggtatttgacaaagaagagctcttagagtgt
attcaacagcttgtgaaattggatcaagaatgggtcccatattcaacatctgctagtctg
tatattcgtcctacattcattggaactgagccttctcttggagtcaagaagcctaccaaa
gccctgctctttgtactcttgagcccagtgggaccttatttttcaagtggaacctttaat
ccagtgtccctgtgggccaatcccaagtatgtaagagcctggaaaggtggaactggggac
tgcaagatgggagggaattacggctcatctctttttgcccaatgtgaagcagtagataat
gggtgtcagcaggtcctgtggctctatggagaggaccatcagatcactgaagtgggaact
atgaatctttttctttactggataaatgaagatggagaagaagaactggcaactcctcca
ctagatggcatcattcttccaggagtgacaaggcggtgcattctggacctggcacatcag
tggggtgaatttaaggtgtcagagagatacctcaccatggatgacttgacaacagccctg
gaggggaacagagtgagagagatgtttggctctggtacagcctgtgttgtttgcccagtt
tctgatatactgtacaaaggcgagacaatacacattccaactatggagaatggtcctaag
ctggcaagccgcatcttgagcaaattaactgatatccagtatggaagagaagagagcgac
tggacaattgtgctatcctga

KEGG   Homo sapiens (human): 587
Entry
587               CDS       T01001                                 
Symbol
BCAT2, BCAM, BCATM, BCT2, HVLI, PP18
Name
(RefSeq) branched chain amino acid transaminase 2
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00280  Valine, leucine and isoleucine degradation
hsa00290  Valine, leucine and isoleucine biosynthesis
hsa00770  Pantothenate and CoA biosynthesis
hsa01100  Metabolic pathways
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
hsa01240  Biosynthesis of cofactors
Module
hsa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Network
nt06024  Valine, leucine and isoleucine degradation
  Element
N00832  Branched-chain amino acids degradation
Disease
H02546  Hypervalinemia and hyperleucine-isoleucinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    587 (BCAT2)
   00280 Valine, leucine and isoleucine degradation
    587 (BCAT2)
   00290 Valine, leucine and isoleucine biosynthesis
    587 (BCAT2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    587 (BCAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    587 (BCAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     587 (BCAT2)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class IV
   587 (BCAT2)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 587
NCBI-ProteinID: NP_001181
OMIM: 113530
HGNC: 977
Ensembl: ENSG00000105552
Vega: OTTHUMG00000183327
Pharos: O15382(Tbio)
UniProt: O15382
Structure
LinkDB
Position
19:complement(48795064..48811029)
AA seq 392 aa
MAAAALGQIWARKLLSVPWLLCGPRRYASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKT
FTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRP
WLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSL
GVSQPTRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLV
QQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQS
LLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIP
TMENGPELILRFQKELKEIQYGIRAHEWMFPV
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggccgcagccgctctggggcagatctgggcacgaaagcttctctctgtcccttggctt
ctgtgtggtcccagaagatatgcctcctccagtttcaaggctgcagacctgcagctggaa
atgacacagaagcctcataagaagcctggccccggcgagcccctggtgtttgggaagaca
tttaccgaccacatgctgatggtggaatggaatgacaagggctggggccagccccgaatc
cagcccttccagaacctcacgctgcacccagcctcctccagcctccactactccctgcag
ctgtttgagggcatgaaggcgttcaaaggcaaagaccagcaggtgcgcctcttccgcccc
tggctcaacatggaccggatgctgcgctcagccatgcgcctgtgcctgccgagtttcgac
aagctggagttgctggagtgcatccgccggctcatcgaagtggacaaggactgggtcccc
gatgccgccggcaccagcctctatgtgcggcctgtgctcattgggaacgagccctcgctg
ggtgtcagccagcccacgcgcgcgctcctgttcgtcattctctgcccagtgggtgcctac
ttccctggaggctccgtgaccccggtctccctcctggccgacccagccttcatccgggcc
tgggtgggcggggtcggcaactacaagttaggtgggaattatgggcccaccgtgttagtg
caacaggaggcactcaagcggggctgtgaacaggtcctctggctgtatgggcccgaccac
cagctcaccgaggtgggaaccatgaacatctttgtctactggacccacgaagatggggtg
ctggagctggtgacgcccccgctgaatggtgttatcctgcctggagtggtcagacagagt
ctactggacatggctcagacctggggtgagttccgggtggtggagcgcacgatcaccatg
aagcagttgctgcgggccctggaggagggccgcgtgcgggaagtctttggctcgggcacc
gcttgccaggtctgcccagtgcaccgaatcctgtacaaagacaggaacctccacattccc
accatggaaaatgggcctgagctgatcctccgcttccagaaggagctgaaggagatccag
tacggaatcagagcccacgagtggatgttcccggtgtga

DBGET integrated database retrieval system