| Entry |
|
|---|
| Symbol |
RAC3
|
|---|
| Name |
(RefSeq) Rac family small GTPase 3
|
|---|
| KO |
| K07861 | Ras-related C3 botulinum toxin substrate 3 |
|
|---|
| Organism |
|
|---|
| Pathway |
| hsa04650 | Natural killer cell mediated cytotoxicity |
| hsa04662 | B cell receptor signaling pathway |
| hsa04664 | Fc epsilon RI signaling pathway |
| hsa04810 | Regulation of actin cytoskeleton |
| hsa05163 | Human cytomegalovirus infection |
| hsa05170 | Human immunodeficiency virus 1 infection |
| hsa05418 | Fluid shear stress and atherosclerosis |
|
|---|
| Network |
nt06124 Chemokine signaling (viruses) nt06135 Cytoskeletal regulation (viruses and bacteria) nt06150 Cytokine-cytokine receptor interaction (viruses) nt06161 Human immunodeficiency virus type 1 (HIV-1) nt06167 Human cytomegalovirus (HCMV) |
|---|
| Element |
| N00394 | HCMV gH to ITGA/B-RhoA signaling pathway |
| N00433 | CXCR4-GNB/G-RAC signaling pathway |
| N00434 | HIV gp120 to CXCR4-GNB/G-RAC signaling pathway |
| N00951 | ITGA/B-RHOG-RAC signaling pathway |
| N01068 | ITGA/B-FAK-RAC signaling pathway |
| N01090 | IGG-FCGR-RAC signaling pathway |
| N01103 | Yersinia YpkA to IGG-FCGR-RAC signaling pathway |
|
|---|
| Disease |
| H02535 | Neurodevelopmental disorder with dysmorphic facies |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
5881 (RAC3)
04014 Ras signaling pathway
5881 (RAC3)
04015 Rap1 signaling pathway
5881 (RAC3)
04310 Wnt signaling pathway
5881 (RAC3)
04370 VEGF signaling pathway
5881 (RAC3)
04071 Sphingolipid signaling pathway
5881 (RAC3)
04024 cAMP signaling pathway
5881 (RAC3)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04510 Focal adhesion
5881 (RAC3)
04520 Adherens junction
5881 (RAC3)
09142 Cell motility
04810 Regulation of actin cytoskeleton
5881 (RAC3)
09150 Organismal Systems
09151 Immune system
04650 Natural killer cell mediated cytotoxicity
5881 (RAC3)
04662 B cell receptor signaling pathway
5881 (RAC3)
04664 Fc epsilon RI signaling pathway
5881 (RAC3)
04062 Chemokine signaling pathway
5881 (RAC3)
09158 Development and regeneration
04360 Axon guidance
5881 (RAC3)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
5881 (RAC3)
05231 Choline metabolism in cancer
5881 (RAC3)
09162 Cancer: specific types
05210 Colorectal cancer
5881 (RAC3)
05212 Pancreatic cancer
5881 (RAC3)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
5881 (RAC3)
05163 Human cytomegalovirus infection
5881 (RAC3)
09171 Infectious disease: bacterial
05135 Yersinia infection
5881 (RAC3)
09166 Cardiovascular disease
05418 Fluid shear stress and atherosclerosis
5881 (RAC3)
05416 Viral myocarditis
5881 (RAC3)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:hsa04031]
5881 (RAC3)
GTP-binding proteins [BR:hsa04031]
Small (monomeric) G-proteins
Rho Family
Rac/Cdc42 [OT]
5881 (RAC3)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| Structure |
|
|---|
| LinkDB |
|
|---|
| Position |
17:82031678..82034204
|
|---|
| AA seq |
192 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLR
DDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKPGKKCTVF |
|---|
| NT seq |
579 nt +upstreamnt +downstreamnt
atgcaggccatcaagtgcgtggtggtcggcgacggcgccgtggggaagacatgcttgctg
atcagctacacgaccaacgccttccccggagagtacatccccaccgtttttgacaactac
tctgccaacgtgatggtggacgggaaaccagtcaacttggggctgtgggacacagcgggt
caggaggactacgatcggctgcggccactctcctacccccaaactgacgtctttctgatc
tgcttctctctggtgagcccggcctccttcgagaatgttcgtgccaagtggtacccggag
gtgcggcaccactgcccccacacgcccatcctcctggtgggcaccaagctggacctccgc
gacgacaaggacaccattgagcggctgcgggacaagaagctggcacccatcacctaccca
cagggcctggccatggcccgggagattggctctgtgaaatacctggagtgctcagccctg
acccagcggggcctgaagacagtgtttgacgaggcgatccgcgcggtgctctgcccgccc
ccagtgaagaagccggggaagaagtgcaccgtcttctag |
|---|
