KEGG   Homo sapiens (human): 6100
Entry
6100              CDS       T01001                                 
Symbol
RP9, PAP-1, PAP1
Name
(RefSeq) RP9 pre-mRNA splicing factor
  KO
K19604  retinitis pigmentosa 9 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6100 (RP9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6100 (RP9)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    6100 (RP9)
 Complex B
    6100 (RP9)
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    6100 (RP9)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    6100 (RP9)
SSDB
Motif
Pfam: AP3D1 Med19 SR-25 Ydc2-catalyt
Other DBs
NCBI-GeneID: 6100
NCBI-ProteinID: NP_976033
OMIM: 607331
HGNC: 10288
Ensembl: ENSG00000164610
Pharos: Q8TA86(Tbio)
UniProt: Q8TA86 A0A090N8Z0
LinkDB
Position
7:complement(33094797..33109404)
AA seq 221 aa
MSSRPGREDVGAAGARRPREPPEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLI
KEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWMPLGKEVKVMQCWRCKRYGHRTGDKEC
PFFIKGNQKLEQFRVAHEDPMYDIIRDNKRHEKDVRIQQLKQLLEDSTSDEDRSSSSSSE
GKEKHKKKKKKEKHKKRKKEKKKKKKRKHKSSKSNEGSDSE
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtcgtcccggcctgggcgcgaggacgtgggggctgcgggcgcgcggcggccgcgtgag
ccgccggagcaggagctgcagcgacgtcgggagcagaagcggcggcgacacgacgcgcag
cagctgcagcagctcaagcacctggagtccttttacgaaaaacctcctcctgggcttatc
aaggaagatgagactaagccagaagattgcataccagatgtaccaggcaatgaacacgcc
agggaatttctggctcatgcaccaactaaaggactttggatgccactggggaaagaagtc
aaagttatgcagtgttggcgttgcaaacgctatggtcaccgaacgggtgacaaagaatgc
cctttctttatcaaaggcaaccaaaagttagagcagttcagagtggcacatgaagatccc
atgtatgacatcatacgagacaataaacgacatgaaaaggacgtaaggatacagcagtta
aaacagttactggaggattctacctcagatgaagataggagcagctccagttcctctgaa
ggtaaagagaaacacaagaaaaagaagaagaaagaaaagcataagaaaaggaagaaagaa
aagaaaaagaagaaaaaacggaagcacaaatcttccaagtcaaatgagggttctgactca
gagtga

DBGET integrated database retrieval system