KEGG   Homo sapiens (human): 6295
Entry
6295              CDS       T01001                                 

Gene name
SAG, RP47, S-AG
Definition
(RefSeq) S-antigen visual arrestin
  KO
K19627  S-arrestin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa
H00787  Congenital stationary night blindness
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    6295 (SAG)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C Transglut_C FliD_C DUF2079
Other DBs
NCBI-GeneID: 6295
NCBI-ProteinID: NP_000532
OMIM: 181031
HGNC: 10521
Ensembl: ENSG00000130561
Vega: OTTHUMG00000153213
Pharos: P10523(Tbio)
UniProt: P10523
LinkDB
Position
2q37.1
AA seq 405 aa
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKK
VYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTY
PFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRK
VQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKK
IKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALD
GKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLM
HPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE
NT seq 1218 nt   +upstreamnt  +downstreamnt
atggcagccagcgggaagaccagcaagtccgaaccgaaccatgttatcttcaagaagatc
tcccgggacaaatcggtgaccatctacctggggaacagagactacatagaccatgtcagc
caagtccagcctgtggatggtgtcgtgttggttgatcctgatcttgtgaagggaaagaaa
gtgtatgtcactctgacctgcgccttccgctatggccaagaggacattgacgtgatcggc
ttgaccttccgcagggacctgtacttctcccgggtccaggtgtatcctcctgtgggggcc
gcgagcacccccacaaaactgcaagagagcctgcttaaaaagctggggagcaacacgtac
ccctttctcctgacgtttcctgactacttgccctgttcagtgatgttgcagccagctcca
caagattcagggaagtcctgtggggttgactttgaggtcaaagcattcgccacagacagc
accgatgccgaagaggacaaaatccccaagaagagctccgtgcgattactgatccgcaaa
gtacagcatgccccacttgagatgggtccccagccccgagctgaggcggcctggcagttc
ttcatgtctgacaagcccctgcaccttgcggtctctctcaacaaagagatctatttccat
ggggagcccatccctgtgaccgtgactgtcaccaataacacagagaagaccgtgaagaag
attaaagcattcgtggaacaggtggccaatgtggttctctactcgagtgattattacgtc
aagcccgtggctatggaggaagcgcaagaaaaagtgccaccaaacagcactttgaccaag
acgctgacgctgctgcccttgctggctaacaatcgagaaaggagaggcattgccctggat
gggaaaatcaagcacgaggacacaaaccttgcctccagcaccatcattaaggagggcata
gaccggaccgtcctgggaatcctggtgtcttaccagatcaaggtgaagctcacagtgtca
ggctttctgggagagctcacctccagtgaagtcgccactgaggtcccattccgcctcatg
caccctcagcctgaggacccagctaaggaaagttatcaggatgcaaatttagtttttgag
gagtttgctcgccataatctgaaagatgcaggagaagctgaggaggggaagagagacaag
aatgacgttgatgagtga

DBGET integrated database retrieval system