Entry |
|
Symbol |
CCL3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3
|
Name |
(RefSeq) C-C motif chemokine ligand 3
|
KO |
|
Organism |
|
Pathway |
hsa04060 | Cytokine-cytokine receptor interaction |
hsa04061 | Viral protein interaction with cytokine and cytokine receptor |
hsa04620 | Toll-like receptor signaling pathway |
hsa05163 | Human cytomegalovirus infection |
|
Network |
nt06124 Chemokine signaling (viruses) nt06150 Cytokine-cytokine receptor interaction (viruses) nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06167 Human cytomegalovirus (HCMV) nt06224 CXCR signaling |
Element |
N00153 | CCR/CXCR-GNB/G-PI3K-RAC signaling pathway |
N00406 | HCMV US28 to GNA12/13-Rho signaling pathway |
N01166 | CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling |
N01167 | VAV vCCI to CCR signaling |
N01168 | CCL3/7 to HCMV US28 signaling |
N01169 | CCL3 to HHV6 U12 signaling |
N01196 | CCL3/4/5/8 to CCR5 signaling |
|
Disease |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
6348 (CCL3)
04061 Viral protein interaction with cytokine and cytokine receptor
6348 (CCL3)
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
6348 (CCL3)
04062 Chemokine signaling pathway
6348 (CCL3)
09160 Human Diseases
09172 Infectious disease: viral
05163 Human cytomegalovirus infection
6348 (CCL3)
09174 Infectious disease: parasitic
05142 Chagas disease
6348 (CCL3)
09163 Immune disease
05323 Rheumatoid arthritis
6348 (CCL3)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
6348 (CCL3)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and growth factors [BR:hsa04052]
6348 (CCL3)
00536 Glycosaminoglycan binding proteins [BR:hsa00536]
6348 (CCL3)
Cytokines and growth factors [BR:hsa04052]
Cytokines
Chemokines
6348 (CCL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
Heparan sulfate / Heparin
Chemokines
6348 (CCL3)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
LinkDB |
|
Position |
17:complement(36088256..36090143)
|
AA seq |
92 aa
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
NT seq |
279 nt +upstreamnt +downstreamnt
atgcaggtctccactgctgcccttgctgtcctcctctgcaccatggctctctgcaaccag
ttctctgcatcacttgctgctgacacgccgaccgcctgctgcttcagctacacctcccgg
cagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaagccc
ggtgtcatcttcctaaccaagcgaagccggcaggtctgtgctgaccccagtgaggagtgg
gtccagaaatatgtcagcgacctggagctgagtgcctga |