| Entry |
|
| Symbol |
CCL3, G0S19-1, LD78, LD78ALPHA, MIP-1-alpha, MIP1A, SCI, SCYA3
|
| Name |
(RefSeq) C-C motif chemokine ligand 3
|
| KO |
|
| Organism |
|
| Pathway |
| hsa04060 | Cytokine-cytokine receptor interaction |
| hsa04061 | Viral protein interaction with cytokine and cytokine receptor |
| hsa04620 | Toll-like receptor signaling pathway |
| hsa05163 | Human cytomegalovirus infection |
|
| Network |
nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06167 Human cytomegalovirus (HCMV) nt06224 CXCR signaling (cancer) nt06533 Chemokine signaling |
| Element |
| N00153 | CCR/CXCR-GNB/G-PI3K-RAC signaling pathway |
| N00406 | HCMV US28 to GNA12/13-Rho signaling pathway |
| N01746 | CCR/CXCR-GNB/G-PI3K signaling pathway |
|
| Disease |
|
| Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
6348 (CCL3)
04061 Viral protein interaction with cytokine and cytokine receptor
6348 (CCL3)
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
6348 (CCL3)
04062 Chemokine signaling pathway
6348 (CCL3)
09160 Human Diseases
09172 Infectious disease: viral
05163 Human cytomegalovirus infection
6348 (CCL3)
09174 Infectious disease: parasitic
05142 Chagas disease
6348 (CCL3)
09163 Immune disease
05323 Rheumatoid arthritis
6348 (CCL3)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
6348 (CCL3)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:hsa04052]
6348 (CCL3)
00536 Glycosaminoglycan binding proteins [BR:hsa00536]
6348 (CCL3)
Cytokines and neuropeptides [BR:hsa04052]
Cytokines
Chemokines
6348 (CCL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
Heparan sulfate / Heparin
Chemokines
6348 (CCL3)
|
| SSDB |
|
| Motif |
|
| Other DBs |
|
| Structure |
|
| LinkDB |
|
| Position |
17:complement(36088256..36090143)
|
| AA seq |
92 aa
MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA |
| NT seq |
279 nt +upstreamnt +downstreamnt
atgcaggtctccactgctgcccttgctgtcctcctctgcaccatggctctctgcaaccag
ttctctgcatcacttgctgctgacacgccgaccgcctgctgcttcagctacacctcccgg
cagattccacagaatttcatagctgactactttgagacgagcagccagtgctccaagccc
ggtgtcatcttcctaaccaagcgaagccggcaggtctgtgctgaccccagtgaggagtgg
gtccagaaatatgtcagcgacctggagctgagtgcctga |