Entry |
|
Symbol |
CCL5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
|
Name |
(RefSeq) C-C motif chemokine ligand 5
|
KO |
|
Organism |
|
Pathway |
hsa04060 | Cytokine-cytokine receptor interaction |
hsa04061 | Viral protein interaction with cytokine and cytokine receptor |
hsa04620 | Toll-like receptor signaling pathway |
hsa04621 | NOD-like receptor signaling pathway |
hsa05120 | Epithelial cell signaling in Helicobacter pylori infection |
hsa05163 | Human cytomegalovirus infection |
hsa05168 | Herpes simplex virus 1 infection |
|
Network |
nt06124 Chemokine signaling (viruses) nt06150 Cytokine-cytokine receptor interaction (viruses) nt06167 Human cytomegalovirus (HCMV) |
Element |
N00406 | HCMV US28 to GNA12/13-Rho signaling pathway |
N00428 | CCR5-GNB/G-PLCB/G-PKC signaling pathway |
N00429 | HCMV UL22A to CCR5-GNB/G-PLCB/G-PKC signaling pathway |
N01166 | CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling |
N01181 | CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling |
N01182 | VAV vCCI to CCR signaling |
N01183 | CCL5/11/13/26/28 to HCMV US28 signaling |
N01184 | CCL5 to HHV6 U12 signaling |
N01185 | CCL5/11 to HHV6 U51 signaling |
N01190 | CCL5/17/22 to CCR4 signaling |
N01196 | CCL3/4/5/8 to CCR5 signaling |
|
Disease |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04668 TNF signaling pathway
6352 (CCL5)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
6352 (CCL5)
04061 Viral protein interaction with cytokine and cytokine receptor
6352 (CCL5)
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
6352 (CCL5)
04621 NOD-like receptor signaling pathway
6352 (CCL5)
04623 Cytosolic DNA-sensing pathway
6352 (CCL5)
04062 Chemokine signaling pathway
6352 (CCL5)
09160 Human Diseases
09172 Infectious disease: viral
05164 Influenza A
6352 (CCL5)
05168 Herpes simplex virus 1 infection
6352 (CCL5)
05163 Human cytomegalovirus infection
6352 (CCL5)
09171 Infectious disease: bacterial
05120 Epithelial cell signaling in Helicobacter pylori infection
6352 (CCL5)
05131 Shigellosis
6352 (CCL5)
09174 Infectious disease: parasitic
05142 Chagas disease
6352 (CCL5)
09163 Immune disease
05323 Rheumatoid arthritis
6352 (CCL5)
09164 Neurodegenerative disease
05020 Prion disease
6352 (CCL5)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
6352 (CCL5)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and growth factors [BR:hsa04052]
6352 (CCL5)
00536 Glycosaminoglycan binding proteins [BR:hsa00536]
6352 (CCL5)
Cytokines and growth factors [BR:hsa04052]
Cytokines
Chemokines
6352 (CCL5)
Glycosaminoglycan binding proteins [BR:hsa00536]
Heparan sulfate / Heparin
Chemokines
6352 (CCL5)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
LinkDB |
|
Position |
17:complement(35871491..35880360)
|
AA seq |
91 aa
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS |
NT seq |
276 nt +upstreamnt +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctag |