KEGG   Homo sapiens (human): 6403
Entry
6403              CDS       T01001                                 

Gene name
SELP, CD62, CD62P, GMP140, GRMP, LECAM3, PADGEM, PSEL
Definition
(RefSeq) selectin P
  KO
K06496  selectin, platelet
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04613  Neutrophil extracellular trap formation
hsa05144  Malaria
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05417  Lipid and atherosclerosis
Drug target
Bimosiamose disodium: D03114
Crizanlizumab: D11480<US>
Inclacumab: D10356
Torapsel: D06194
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    6403 (SELP)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    6403 (SELP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    6403 (SELP)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    6403 (SELP)
  09174 Infectious disease: parasitic
   05144 Malaria
    6403 (SELP)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6403 (SELP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    6403 (SELP)
   04090 CD molecules [BR:hsa04090]
    6403 (SELP)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6403 (SELP)
   04091 Lectins [BR:hsa04091]
    6403 (SELP)
Cell adhesion molecules [BR:hsa04515]
 Selectins
  Selectin family
   6403 (SELP)
CD molecules [BR:hsa04090]
 Proteins
  6403 (SELP)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   6403 (SELP)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 4: Selectins
   6403 (SELP)
SSDB
Motif
Pfam: Sushi Lectin_C EGF EGF_2
Other DBs
NCBI-GeneID: 6403
NCBI-ProteinID: NP_002996
OMIM: 173610
HGNC: 10721
Ensembl: ENSG00000174175
Vega: OTTHUMG00000034685
Pharos: P16109(Tchem)
UniProt: P16109 Q6NUL9 A0A024R8Y9
LinkDB
Structure
PDB: 
1G1S 1G1Q 1G1R 1FSB

Position
1q24.2
AA seq 830 aa
MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC
QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPS
KLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
PEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRV
RGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGF
MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNE
GLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFIC
DEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHF
SCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPG
TFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNL
WGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVA
STIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
NT seq 2493 nt   +upstreamnt  +downstreamnt
atggccaactgccaaatagccatcttgtaccagagattccagagagtggtctttggaatt
tcccaactcctttgcttcagtgccctgatctctgaactaacaaaccagaaagaagtggca
gcatggacttatcattacagcacaaaagcatactcatggaatatttcccgtaaatactgc
cagaatcgctacacagacttagtggccatccagaataaaaatgaaattgattacctcaat
aaggtcctaccctactacagctcctactactggattgggatccgaaagaacaataagaca
tggacatgggtgggaaccaaaaaggctctcaccaacgaggctgagaactgggctgataat
gaacctaacaacaaaaggaacaacgaggactgcgtggagatatacatcaagagtccgtca
gcccctggcaagtggaatgatgagcactgcttgaagaaaaagcacgcattgtgttacaca
gcctcctgccaggacatgtcctgcagcaaacaaggagagtgcctcgagaccatcgggaac
tacacctgctcctgttaccctggattctatgggccagaatgtgaatacgtgagagagtgt
ggagaacttgagctccctcaacacgtgctcatgaactgcagccaccctctgggaaacttc
tcttttaactcgcagtgcagcttccactgcactgacgggtaccaagtaaatgggcccagc
aagctggaatgcttggcttctggaatctggacaaataagcctccacagtgtttagctgcc
cagtgcccacccctgaagattcctgaacgaggaaacatgacctgccttcattctgcaaaa
gcattccagcatcagtctagctgcagcttcagttgtgaagagggatttgcattagttgga
ccggaagtggtgcaatgcacagcctcgggggtatggacagccccagccccagtgtgtaaa
gctgtgcagtgtcagcacctggaagcccccagtgaaggaaccatggactgtgttcatccg
ctcactgcttttgcctatggctccagctgtaaatttgagtgccagcccggctacagagtg
aggggcttggacatgctccgctgcattgactctggacactggtctgcacccttgccaacc
tgtgaggctatttcgtgtgagccgctggagagtcctgtccacggaagcatggattgctct
ccatccttgagagcgtttcagtatgacaccaactgtagcttccgctgtgctgaaggtttc
atgctgagaggagccgatatagttcggtgtgataacttgggacagtggacagcaccagcc
ccagtctgtcaagctttgcagtgccaggatctcccagttccaaatgaggcccgggtgaac
tgctcccaccccttcggtgcctttaggtaccagtcagtctgcagcttcacctgcaatgaa
ggcttgctcctggtgggagcaagtgtgctacagtgcttggctactggaaactggaattct
gttcctccagaatgccaagccattccctgcacacctttgctaagccctcagaatggaaca
atgacctgtgttcaacctcttggaagttccagttataaatccacatgtcaattcatctgt
gacgagggatattctttgtctggaccagaaagattggattgtactcgatcgggacgctgg
acagactccccaccaatgtgtgaagccatcaagtgcccagaactctttgccccagagcag
ggcagcctggattgttctgacactcgtggagaattcaatgttggctccacctgccatttc
tcttgtgacaacggctttaagctggaggggcccaataatgtggaatgcacaacttctgga
agatggtcagctactccaccaacctgcaaaggcatagcatcacttcctactccaggggtg
caatgtccagccctcaccactcctgggcagggaaccatgtactgtaggcatcatccggga
acctttggttttaataccacttgttactttggctgcaacgctggattcacactcatagga
gacagcactctcagctgcagaccttcaggacaatggacagcagtaactccagcatgcaga
gctgtgaaatgctcagaactacatgttaataagccaatagcgatgaactgctccaacctc
tggggaaacttcagttatggatcaatctgctctttccattgtctagagggccagttactt
aatggctctgcacaaacagcatgccaagagaatggccactggtcaactaccgtgccaacc
tgccaagcaggaccattgactatccaggaagccctgacttactttggtggagcggtggct
tctacgataggtctgataatgggtgggacgctcctggctttgctaagaaagcgtttcaga
caaaaagatgatgggaaatgccccttgaatcctcacagccacctaggaacatatggagtt
tttacaaacgctgcatttgacccgagtccttaa

DBGET integrated database retrieval system