KEGG   Homo sapiens (human): 64283
Entry
64283             CDS       T01001                                 

Gene name
ARHGEF28, RGNEF, RIP2, p190RHOGEF
Definition
(RefSeq) Rho guanine nucleotide exchange factor 28
  KO
K21072  A-kinase anchor protein 28
Organism
hsa  Homo sapiens (human)
Pathway
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01072  ITGA/B-RhoGEF-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    64283 (ARHGEF28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64283 (ARHGEF28)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    64283 (ARHGEF28)
SSDB
Motif
Pfam: PH_16 RhoGEF C1_1 PH C1_2 PHD Prok-RING_1 PH_13
Other DBs
NCBI-GeneID: 64283
NCBI-ProteinID: NP_001171164
OMIM: 612790
HGNC: 30322
Ensembl: ENSG00000214944
Vega: OTTHUMG00000162454
Pharos: Q8N1W1(Tbio)
UniProt: Q8N1W1
LinkDB
Structure
PDB: 
6BC0 6BC1

Position
5q13.2
AA seq 1705 aa
MELSCSEAPLYGQMMIYAKFDKNVYLPEDAEFYFTYDGSHQRHVMIAERIEDNVLQSSVP
GHGLQETVTVSVCLCSEGYSPVTMGSGSVTYVDNMACRLARLLVTQANRLTACSHQTLLT
PFALTAGALPALDEELVLALTHLELPLEWTVLGSSSLEVSSHRESLLHLAMRWGLAKLSQ
FFLCLPGGVQALALPNEEGATPLDLALREGHSKLVEDVTNFQGRWSPSFSRVQLSEEASL
HYIHSSETLTLTLNHTAEHLLEADIKLFRKYFWDRAFLVKAFEPEARPEERTAMPSSGAE
TEEEIKNSVSSRSAAEKEDIKRVKSLVVQHNEHEDQHSLDLDRSFDILKKSKPPSTLLAA
GRLSDMLNGGDEVYANCMVIDQVGDLDISYINIEGITATTSPESRGCTLWPQSSKHTLPT
ETSPSVYPLSENVEGTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLD
ALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNISRAESLPLSS
NLQSKESLLSGVRSRSYSCSSPKISLGKTRLVRELTVCSSSEEQRAYSLSEPPRENRIQE
EEWDKYIIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKTKSKDAKDKEKLNRHQFAPGTF
SGVLQCLVCDKTLLGKESLQCSNCNANVHKGCKDAAPACTKKFQEKYNKNKPQTILGNSS
FRDIPQPGLSLHPSSSVPVGLPTGRRETVGQVHPLSRSVPGTTLESFRRSATSLESESDH
NSCRSRSHSDELLQSMGSSPSTESFIMEDVVDSSLWSDLSSDAQEFEAESWSLVVDPSFC
NRQEKDVIKRQDVIFELMQTEMHHIQTLFIMSEIFRKGMKEELQLDHSTVDKIFPCLDEL
LEIHRHFFYSMKERRQESCAGSDRNFVIDRIGDILVQQFSEENASKMKKIYGEFCCHHKE
AVNLFKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKER
TEEHKDLRKALCLIKDMIATVDLKVNEYEKNQKWLEILNKIENKTYTKLKNGHVFRKQAL
MSEERTLLYDGLVYWKTATGRFKDILALLLTDVLLFLQEKDQKYIFAAVDQKPSVISLQK
LIAREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEKGGRTSE
SDEDKRKAEARVAKIQQCQEILTNQDQQICAYLEEKLHIYAELGELSGFEDVHLEPHLLI
KPDPGEPPQAASLLAAALKEAESLQVAVKASQMGAVSQSCEDSCGDSVLADTLSSHDVPG
SPTASLVTGGREGRGCSDVDPGIQGVVTDLAVSDAGEKVECRNFPGSSQSEIIQAIQNLT
RLLYSLQAALTIQDSHIEIHRLVLQQQEGLSLGHSILRGGPLQDQKSRDADRQHEELANV
HQLQHQLQQEQRRWLRRCEQQQRAQATRESWLQERERECQSQEELLLRSRGELDLQLQEY
QHSLERLREGQRLVEREQARMRAQQSLLGHWKHGRQRSLPAVLLPGGPEVMELNRSESLC
HENSFFINEALVQMSFNTFNKLNPSVIHQDATYPTTQSHSDLVRTSEHQVDLKVDPSQPS
NVSHKLWTAAGSGHQILPFHESSKDSCKNDLDTSHTESPTPHDSNSHRPQLQAFITEAKL
NLPTRTMTRQDGETGDGAKENIVYL
NT seq 5118 nt   +upstreamnt  +downstreamnt
atggagttgagctgcagcgaagcacctctttacgggcagatgatgatctatgcgaagttt
gacaaaaatgtgtatcttcctgaagatgctgagttttactttacttatgacggatctcat
cagcgacatgtcatgattgcagagcgcatcgaggataacgttctccagtccagcgtccca
ggccatgggcttcaggagacggtgacggtatctgtgtgcctctgctcggaaggttactct
ccggtgaccatgggctctggctcagtgacctacgtggacaacatggcttgcaggctggct
cgtctgctggtgacgcaggccaatcgcctcacagcctgcagccaccagaccctgctgacc
ccatttgccttgacggcaggagcactgcctgccttggatgaggagctcgtgctggctctg
acccatctggaattgcctctagagtggactgtgttgggaagttcttcacttgaagtatct
tctcacagagaatctcttctacacctggctatgagatggggcctggctaaactttcccag
ttcttcttgtgtctcccggggggagtccaggccttggctttacccaacgaagagggtgcc
acaccattagacttagctttacgtgaaggacactccaagctggtggaagacgtcacaaat
tttcagggcagatggtccccaagcttctcccgagtgcagctcagtgaagaagcctccttg
cattacattcactcatcggaaacgctgaccctgaccctgaaccacacagccgagcatttg
ttggaggcagatattaaactcttccggaaatacttttgggatagagcctttcttgtcaag
gcctttgagccagaagccaggccagaggaaagaacagctatgccctccagcggtgcagaa
actgaagaagagattaagaattcagtgtccagcagatcagcagctgaaaaggaagatata
aagcgtgtcaaaagcctggtggttcaacacaatgaacatgaagaccagcacagcctagat
ttggatcgctccttcgatatcctaaaaaaatccaagccgccctcgacattgcttgctgca
ggccggctttcagacatgctgaatggaggtgatgaagtctacgctaactgtatggtgatt
gatcaggttggtgatttggatatcagctatattaatatagagggaatcactgccactacc
agccctgaatccagaggttgcactctgtggcctcagagcagcaaacacacccttcctaca
gaaaccagtcccagtgtgtacccacttagtgaaaatgtcgaagggacagcacacactgaa
gcccagcagtccttcatgtcaccatcaagttcgtgtgcttccaacttgaatctttctttt
ggttggcatggatttgaaaaggaacaaagtcatctaaagaaaagaagttctagccttgat
gccttggacgccgacagtgaaggggaagggcattctgagccatcccacatctgttacact
ccagggtctcagagctcctcaagaactgggattcctagtggggatgaattggactctttt
gagactaacactgaaccggattttaatatctccagggctgaatcccttcctctatcaagt
aatctacagtcgaaggaatcactgctttctggagttcgctcacgttcttattcttgctca
tcacccaaaatttctttaggaaaaactcgtttggtgcgtgaattaacagtatgcagttca
agtgaagagcaaagagcttacagcttatcggagccaccaagagaaaacagaattcaggaa
gaagaatgggataaatacatcatacctgccaaatcagagtctgaaaaatataaagtgagt
cgaactttcagtttcctcatgaataggatgactagccctcggaataaatcaaagacaaaa
agcaaggatgccaaagataaagagaagctgaatcgacatcagtttgccccaggaacattc
tctggggttctgcagtgtttggtttgtgataaaacactcctggggaaagagtcactgcag
tgttctaactgtaatgcaaatgtgcacaaaggttgtaaagatgctgcgcctgcatgcacc
aagaaattccaagagaaatataacaagaacaaaccacagaccatccttggaaattcttca
tttagagacatcccacagcctggtctctccttgcacccttcttcctccgtgcctgttgga
ttgccgactggaaggagggagactgtgggacaggtccatccattgtccagaagtgttcca
ggcaccaccttggaaagcttcaggaggtcagccacatccttggagtctgagagtgaccat
aacagctgcagaagcaggtctcattctgatgagctgctacagtccatgggctcttctccc
tctacagagtctttcataatggaagatgttgtggattcttctctgtggagtgacctcagc
agtgatgcccaggagtttgaagcagaatcttggagtcttgtggtggatccctcattttgt
aataggcaggagaaggatgtcatcaaaagacaggatgtcatttttgagctaatgcaaaca
gagatgcatcacatccagaccctgttcatcatgtctgagatcttcaggaaaggcatgaaa
gaggagctgcagctggaccacagcaccgtggataaaattttcccctgtttagatgagttg
cttgaaatccacaggcatttcttctacagtatgaaggaacgaaggcaggaatcctgtgct
ggcagcgacaggaattttgtgatcgaccgaattggagatattttggtacaacagttttca
gaagaaaatgcaagtaaaatgaagaaaatatatggagaattctgttgccatcataaagaa
gctgttaacctctttaaagaactccagcagaataaaaagtttcagaattttattaagctc
cgaaatagtaatcttttggctcgacgccgaggaattccagaatgcattctgttggtcact
cagcgtattacaaaataccctgtcttggtggaaaggatattgcagtacacaaaggaaaga
actgaggaacataaagacttacgcaaagcgctttgcttaattaaagacatgattgcaaca
gtggatttaaaagtcaatgaatatgagaaaaaccaaaaatggcttgagatcctaaataag
attgaaaacaaaacatacacgaagctcaaaaatggacatgtgtttaggaagcaggcactg
atgagtgaagaaaggactctgttatatgatggccttgtttactggaaaactgctacaggt
cgtttcaaagatatcctagctctacttctaactgatgtgctgctctttttacaagaaaaa
gaccagaaatacatctttgcagccgttgatcagaagccatcagttatttcccttcaaaag
cttattgctagagaagttgctaatgaggagagaggaatgtttctgatcagtgcttcatct
gctggtcctgagatgtatgaaattcacaccaattccaaggaggaacgcaataactggatg
agacggatccagcaggctgtagaaagttgtcctgaagaaaaagggggaaggacaagtgaa
tctgatgaagacaagaggaaagctgaagccagagtggccaaaattcagcaatgtcaagaa
atactcactaaccaagaccaacaaatttgtgcgtatttggaggagaagctgcatatctat
gctgaacttggagaactgagcggatttgaggacgtccatctagagccccacctccttatt
aaacctgacccaggcgagcctccccaggcagcctcattactggcagcagcactgaaagaa
gctgagagcctacaagttgcagtgaaggcctcacagatgggcgccgtgagtcaatcatgt
gaggacagttgtggagactctgtcttggcggacacactcagttctcatgatgtaccagga
tcaccgactgcctcattagtcacaggagggagagaaggaagaggctgttcggatgtggat
cccgggatccagggtgtggtaaccgacttggccgtctctgatgcaggggagaaggtggaa
tgtagaaattttccaggttcttcacaatcagagattatacaagccatacagaatttaacc
cgtctcttatacagccttcaggccgccttgaccattcaggacagccacattgagatccac
aggctggttctccagcagcaggagggcctgtctctcggccactctatcctccgaggcggc
cccttgcaggaccagaagtctcgcgacgcggacaggcagcatgaggagctggccaatgtg
caccagcttcagcaccagctccagcaggagcagcggcgctggctgcgcaggtgtgagcag
cagcagcgggcgcaggcgaccagggagagctggctgcaggagcgggagcgggagtgccag
tcgcaggaggagctgctgctgcggagccggggcgagctggacctccagctccaggagtac
cagcacagcctggagcggctgagggagggccagcgcctggtggagagggagcaggcgagg
atgcgggcccagcagagcctgctgggccactggaagcacggccggcagaggagcctgccc
gcggtgctccttccgggtggccccgaggtaatggaacttaatcgatctgagagtttatgt
catgaaaactcattcttcatcaatgaagctttagtacaaatgtcatttaacactttcaac
aaactgaatccatcagttatccatcaggatgccacttaccctacaactcaatctcattct
gacttggtgaggactagtgaacatcaagtagacctcaaggtggacccttctcagccttcg
aatgtcagtcacaaactgtggacagccgctggttccggccatcagatacttcctttccat
gaaagcagcaaggattcttgtaaaaatgatttggacacctcccacactgagtccccaacc
ccccatgactcaaattcacaccgccctcaactgcaggcgtttataacagaagcaaagcta
aatctaccgacaaggacaatgaccagacaagatggggaaactggagatggagccaaagaa
aatattgtttacctctaa

DBGET integrated database retrieval system