KEGG   Homo sapiens (human): 6432
Entry
6432              CDS       T01001                                 
Symbol
SRSF7, 9G8, AAG3, SFRS7
Name
(RefSeq) serine and arginine rich splicing factor 7
  KO
K12896  serine/arginine-rich splicing factor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
hsa05168  Herpes simplex virus 1 infection
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6432 (SRSF7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6432 (SRSF7)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6432 (SRSF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6432 (SRSF7)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6432 (SRSF7)
SSDB
Motif
Pfam: RRM_1 zf-CCHC RRM_5 zf-CCHC_3
Other DBs
NCBI-GeneID: 6432
NCBI-ProteinID: NP_001026854
OMIM: 600572
HGNC: 10789
Ensembl: ENSG00000115875
Vega: OTTHUMG00000102076
Pharos: Q16629(Tbio)
UniProt: Q16629
Structure
LinkDB
Position
2:complement(38743599..38751494)
AA seq 238 aa
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSR
SGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
NT seq 717 nt   +upstreamnt  +downstreamnt
atgtcgcgttacgggcggtacggaggagaaaccaaggtgtatgttggtaacctgggaact
ggcgctggcaaaggagagttagaaagggctttcagttattatggtcctttaagaactgta
tggattgcgagaaatcctccaggatttgcctttgtggaattcgaagatcctagagatgca
gaagatgcagtacgaggactggatggaaaggtgatttgtggctcccgagtgagggttgaa
ctatcgacaggcatgcctcggagatcacgttttgatagaccacctgcccgacgtcccttt
gatccaaatgatagatgctatgagtgtggcgaaaagggacattatgcttatgattgtcat
cgttacagccggcgaagaagaagcaggtcacggtctagatcacattctcgatccagagga
aggcgatactctcgctcacgcagcaggagcaggggacgaaggtcaaggtcagcatctcct
cgacgatcaagatctatctctcttcgtagatcaagatcagcttcactcagaagatctagg
tctggttctataaaaggatcgaggtatttccaatccccgtcgaggtcaagatcaagatcc
aggtctatttcacgaccaagaagcagccgatcaaagtccagatctccatctccaaaaaga
agtcgttccccatcaggaagtcctcgcagaagtgcaagtcctgaaagaatggactga

DBGET integrated database retrieval system