Homo sapiens (human): 644672 Help Entry 644672            CDS       T01001                                  Symbol CLDN25 Name (RefSeq) claudin 25   KO K06087   claudin Organism hsa  Homo sapiens (human) Pathway hsa03272   Virion - Hepatitis viruses hsa04382   Cornified envelope formation hsa04514   Cell adhesion molecules hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa05130   Pathogenic Escherichia coli infection hsa05160   Hepatitis C Network nt06180  Pathogenic Escherichia coli   Element N01287   Tight junction-Actin signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     644672 (CLDN25)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     644672 (CLDN25)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     644672 (CLDN25)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     644672 (CLDN25)   09158 Development and regeneration    04382 Cornified envelope formation     644672 (CLDN25)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     644672 (CLDN25)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     644672 (CLDN25)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     644672 (CLDN25)    04147 Exosome [BR:hsa04147]     644672 (CLDN25)    04515 Cell adhesion molecules [BR:hsa04515]     644672 (CLDN25) Cilium and associated proteins [BR:hsa03037]  Other cilia and associated proteins   Stereociliary proteins    644672 (CLDN25) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    644672 (CLDN25)   Exosomal proteins of colorectal cancer cells    644672 (CLDN25) Cell adhesion molecules [BR:hsa04515]  Immunoglobulin superfamily   L1 family    644672 (CLDN25) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  644672 NCBI-ProteinID:  NP_001094859 OMIM:  620812 HGNC:  37218 Ensembl:  ENSG00000228607 UniProt:  C9JDP6 LinkDB All DBs Position 11:113779796..113780485 Genome browser AA seq 229 aa AA seqDB search MAWSFRAKVQLGGLLLSLLGWVCSCVTTILPQWKTLNLELNEMETWIMGIWEVCVDREEV ATVCKAFESFLSLPQELQVARILMVASHGLGLLGLLLCSFGSECFQFHRIRWVFKRRLGL LGRTLEASASATTLLPVSWVAHATIQDFWDDSIPDIIPRWEFGGALYLGWAAGIFLALGG LLLIFSACLGKEDVPFPLMAGPTVPLSCAPVEESDGSFHLMLRPRNLVI NT seq 690 nt NT seq  +upstreamnt  +downstreamnt atggcctggagtttccgtgcaaaagtccagctcggggggctacttctctccctccttggc tgggtctgctcctgtgttaccaccatcctgccccagtggaagactcttaatctggaactg aacgagatggagacctggatcatggggatttgggaggtctgcgtggatcgagaggaagtc gccactgtgtgcaaggcctttgaatccttcttgtctctgccccaggagctccaggtagcc cgcatcctcatggtagcctcccatgggctgggcctattggggcttttgctctgcagcttt gggtctgaatgcttccagtttcacaggatcagatgggtattcaagaggcggcttggtctc ctgggaaggactttggaggcatccgcttcagccactaccctccttccagtctcctgggtg gcccatgccacaatccaagacttctgggatgacagcatccctgacatcatacctcggtgg gagtttggaggtgccctctacttgggctgggctgctggtattttcctggctcttggtggg ctactcctcatcttctcggcctgcctgggaaaagaagatgtgccttttcctttgatggct ggtcccacagtccccctatcctgtgctccagtggaggagtcagatggctccttccacctc atgctaagacctaggaacctggtcatctag

DBGET integrated database retrieval system