KEGG   Homo sapiens (human): 6629
Entry
6629              CDS       T01001                                 
Symbol
SNRPB2, Msl1, U2B''
Name
(RefSeq) small nuclear ribonucleoprotein polypeptide B2
  KO
K11094  U2 small nuclear ribonucleoprotein B''
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6629 (SNRPB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6629 (SNRPB2)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    6629 (SNRPB2)
 Complex B
    6629 (SNRPB2)
 Complex C
   U2 SnRNP specific factors
    6629 (SNRPB2)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_5 xRRM
Other DBs
NCBI-GeneID: 6629
NCBI-ProteinID: NP_003083
OMIM: 603520
HGNC: 11155
Ensembl: ENSG00000125870
Pharos: P08579(Tbio)
UniProt: P08579
Structure
LinkDB
Position
20:16730026..16742564
AA seq 225 aa
MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELG
SSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTT
NKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEV
RLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
NT seq 678 nt   +upstreamnt  +downstreamnt
atggatatcagaccaaatcatacaatttatatcaacaatatgaatgacaaaattaaaaag
gaagaattgaagagatccctatatgccctgttttctcagtttggtcatgtggtggacatt
gtggctttaaagaccatgaagatgagggggcaggcctttgtcatatttaaggaactgggc
tcatccacaaatgccttgagacagctacaaggatttccattttatggtaaaccaatgcga
atacagtatgcaaaaacagattcggatataatatcaaaaatgcgtggaacttttgctgac
aaagaaaagaaaaaagaaaagaaaaaagccaaaactgtggaacagactgcaacaaccaca
aacaaaaagcctggccagggaactccaaattcagctaatacccaaggaaattcaacacca
aatcctcaggtccctgattaccctccaaactatattttattccttaataacttaccagaa
gagactaatgagatgatgttatccatgctgtttaatcagttccctggcttcaaggaagta
cgtctggtaccagggaggcatgacattgcttttgttgaatttgaaaatgatgggcaggct
ggagctgccagggatgctttacagggatttaagatcacaccgtcccatgctatgaagatc
acctatgccaagaaataa

DBGET integrated database retrieval system