Homo sapiens (human): 6700 Help Entry 6700              CDS       T01001                                  Symbol SPRR2A Name (RefSeq) small proline-rich protein 2A   KO K28331   small proline-rich protein Organism hsa  Homo sapiens (human) Pathway hsa04382   Cornified envelope formation Network nt06545  Cornified envelope formation   Element N01924   Loricrin oligomerization with small proline-rich proteins and further stabilization Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     6700 (SPRR2A) SSDB OrthologParalogGFIT Motif Pfam:  SPRR2 Motif Other DBs NCBI-GeneID:  6700 NCBI-ProteinID:  NP_005979 OMIM:  182267 HGNC:  11261 Ensembl:  ENSP00000376423.2 UniProt:  P35326 LinkDB All DBs Position 1:complement(153056120..153057512) Genome browser AA seq 72 aa AA seqDB search MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPS PPCQSKYPPKSK NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtcttatcaacagcagcagtgcaagcagccctgccagccacctcctgtgtgccccacg ccaaagtgcccagagccatgtccacccccgaagtgccctgagccctgcccaccaccaaag tgtccacagccctgcccacctcagcagtgccagcagaaatatcctcctgtgacaccttcc ccaccctgccagtcaaagtatccaccgaagagcaagtaa

DBGET integrated database retrieval system