KEGG   Homo sapiens (human): 6722
Entry
6722              CDS       T01001                                 
Symbol
SRF, MCM1
Name
(RefSeq) serum response factor
  KO
K04378  serum response factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
  Element
N00509  HTLV-1 Tax to SRF-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6722 (SRF)
   04022 cGMP-PKG signaling pathway
    6722 (SRF)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    6722 (SRF)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    6722 (SRF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6722 (SRF)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box responders to external signals
    6722 (SRF)
SSDB
Motif
Pfam: SRF-TF
Other DBs
NCBI-GeneID: 6722
NCBI-ProteinID: NP_003122
OMIM: 600589
HGNC: 11291
Ensembl: ENSG00000112658
Pharos: P11831(Tbio)
UniProt: P11831 A0A024RD16
Structure
LinkDB
Position
6:43171269..43181506
AA seq 508 aa
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
IGQQAGSSSNLTELQVVNLDTAHSTKSE
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgttaccgacccaagctggggccgcggcggctctgggccggggctcggccctggggggc
agcctgaaccggaccccgacggggcggccgggcggcggcggcgggacacgcggggctaac
gggggccgggtccccgggaatggcgcggggctcgggcccggccgcctggagcgggaggct
gcggcagcggcggcaaccaccccggcgcccaccgcgggggccctctacagcggcagcgag
ggcgactcggagtcgggcgaggaggaggagctgggcgccgagcggcgcggcctgaagcgg
agcctgagcgagatggagatcggtatggtggtcggtgggcccgaggcgtcggcagcggcc
accgggggctacgggccggtgagcggcgcggtgagcggggccaagccgggtaagaagacc
cggggccgcgtgaagatcaagatggagttcatcgacaacaagctgcggcgctacacgacc
ttcagcaagaggaagacgggcatcatgaagaaggcctatgagctgtccacgctgacaggg
acacaggtgctgttgctggtggccagtgagacaggccatgtgtatacctttgccacccga
aaactgcagcccatgatcaccagtgagaccggcaaggcactgattcagacctgcctcaac
tcgccagactctccaccccgttcagaccccacaacagaccagagaatgagtgccactggc
tttgaagagacagatctcacctaccaggtgtcggagtctgacagcagtggggagaccaag
gacacactgaagccggcgttcacagtcaccaacctgccgggtacaacctccaccatccaa
acagcacctagcacctctaccaccatgcaagtcagcagcggcccctcctttcccatcacc
aactacctggcaccagtgtctgctagtgtcagccccagtgctgtcagcagtgccaatggg
actgtgctgaagagtacaggcagcggccctgtctcctctgggggccttatgcagctgcct
accagcttcaccctcatgcctggtggggcagtggcccagcaggtcccagtgcaggccatt
caagtgcaccaggccccacagcaagcgtctccctcccgtgacagcagcacagacctcacg
cagacctcctccagcgggacagtgacgctgcccgccaccatcatgacgtcatccgtgccc
acaactgtgggtggccacatgatgtaccctagcccgcatgcggtgatgtatgcccccacc
tcgggcctgggtgatggcagcctcaccgtgctgaatgccttctcccaggcaccatccacc
atgcaggtgtcacacagccaggtccaggagccaggtggcgtcccccaggtgttcctgaca
gcatcatctgggacagtgcagatccctgtttcagcagttcagctccaccagatggctgtg
atagggcagcaggccgggagcagcagcaacctcaccgagctacaggtggtgaacctggac
accgcccacagcaccaagagtgaatga

DBGET integrated database retrieval system