KEGG   Homo sapiens (human): 6799
Entry
6799              CDS       T01001                                 

Symbol
SULT1A2, HAST4, P-PST, P-PST_2, ST1A2, STP2, TSPST2
Name
(RefSeq) sulfotransferase family 1A member 2
  KO
K01014  aryl sulfotransferase [EC:2.8.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05204  Chemical carcinogenesis - DNA adducts
Network
nt06250  DNA adduct formation
  Element
N01371  PhIP to DNA adducts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    6799 (SULT1A2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.1  aryl sulfotransferase
     6799 (SULT1A2)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 Syntaxin
Other DBs
NCBI-GeneID: 6799
NCBI-ProteinID: NP_001045
OMIM: 601292
HGNC: 11454
Ensembl: ENSG00000197165
Vega: OTTHUMG00000048082
Pharos: P50226(Tbio)
UniProt: P50226
LinkDB
Structure
PDB: 
1Z29

Position
16p11.2
AA seq 295 aa
MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
IYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLD
QKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNY
TTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSEL
NT seq 888 nt   +upstreamnt  +downstreamnt
atggagctgatccaggacatctctcgcccgccactggagtacgtgaagggggtcccgctc
atcaagtactttgcagaggcactggggcccctgcagagcttccaggcccggcctgatgac
ctgctcatcagcacctaccccaagtccggcaccacctgggtgagccagattctggacatg
atctaccagggcggtgacctggaaaagtgtcaccgagctcccatcttcatgcgggtgccc
ttccttgagttcaaagtcccagggattccctcagggatggagactctgaaaaacacacca
gccccacgactcctgaagacacacctgcccctggctctgctcccccagactctgttggat
cagaaggtcaaggtggtctatgttgcccgcaacgcaaaggatgtggcggtttcctactac
cacttctaccacatggccaaagtgtaccctcaccctgggacctgggaaagcttcctggag
aagttcatggctggagaagtgtcctatgggtcctggtaccagcacgtgcaagagtggtgg
gagctgagccgcacccaccctgttctctacctcttctatgaagacatgaaggagaacccc
aaaagggagattcaaaagatcctggagtttgtggggcgctccctgccagaggagactgtg
gacctcatggttgagcacacgtcgttcaaggagatgaagaagaaccctatgaccaactac
accaccgtccgccgggagttcatggaccacagcatctcccccttcatgaggaaaggcatg
gctggggactggaagaccaccttcaccgtggcgcagaatgagcgcttcgatgcggactat
gcgaagaagatggcaggctgcagcctcagcttccgctctgagctgtga

DBGET integrated database retrieval system