KEGG   Homo sapiens (human): 6818
Entry
6818              CDS       T01001                                 

Symbol
SULT1A3, HAST, HAST3, M-PST, ST1A3, ST1A3/ST1A4, ST1A4, ST1A5, STM, TL-PST
Name
(RefSeq) sulfotransferase family 1A member 3
  KO
K01014  aryl sulfotransferase [EC:2.8.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05204  Chemical carcinogenesis - DNA adducts
Network
nt06250  DNA adduct formation
  Element
N01371  PhIP to DNA adducts
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    6818 (SULT1A3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.1  aryl sulfotransferase
     6818 (SULT1A3)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3 Syntaxin
Other DBs
NCBI-GeneID: 6818
NCBI-ProteinID: NP_808220
OMIM: 600641
HGNC: 11455
Ensembl: ENSG00000261052
Vega: OTTHUMG00000048083
Pharos: P0DMN0(Tbio) P0DMM9(Tbio)
UniProt: P0DMM9 P0DMN0 Q1ET61
LinkDB
Structure
PDB: 
1CJM 2A3R

Position
16p11.2
AA seq 295 aa
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDM
IYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLD
QKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNY
TTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
NT seq 888 nt   +upstreamnt  +downstreamnt
atggagctgatccaggacacctcccgcccgccactggagtacgtgaagggggtcccgctc
atcaagtactttgcagaggcactggggcccctgcagagcttccaagcccgacctgatgac
ctgctcatcaacacctaccccaagtctggcaccacctgggtgagccagatactggacatg
atctaccagggcggcgacctagagaagtgtaaccgggctcccatctacgtacgggtgccc
ttccttgaggtcaatgatccaggggaaccctcagggctggagactctgaaagacacaccg
cccccacggctcatcaagtcacacctgcccctggctctgctccctcagactctgttggat
cagaaggtcaaggtggtctatgttgcccgaaacccaaaggacgtggcggtctcctactac
catttccaccgtatggaaaaggcgcaccctgagcctgggacctgggacagcttcctggaa
aagttcatggctggagaagtgtcctacgggtcctggtaccagcacgtgcaggagtggtgg
gagctgagccgcacccaccctgttctctacctcttctatgaagacatgaaggagaacccc
aaaagggagattcaaaagatcctggagtttgtggggcgctccctgccagaggagaccatg
gacttcatggttcagcacacgtcgttcaaggagatgaagaagaaccctatgaccaactac
accaccgtcccccaggagctcatggaccacagcatctcccccttcatgaggaaaggcatg
gctggggactggaagaccaccttcaccgtggcgcagaatgagcgcttcgatgcggactat
gcggagaagatggcaggctgcagcctcagcttccgctctgagctgtga

DBGET integrated database retrieval system