KEGG   Homo sapiens (human): 6926
Entry
6926              CDS       T01001                                 
Symbol
TBX3, TBX3-ISO, UMS, XHL
Name
(RefSeq) T-box transcription factor 3
  KO
K10177  T-box protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H00637  Ulnar-mammary syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    6926 (TBX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6926 (TBX3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   T-box
    6926 (TBX3)
SSDB
Motif
Pfam: T-box TBX
Other DBs
NCBI-GeneID: 6926
NCBI-ProteinID: NP_057653
OMIM: 601621
HGNC: 11602
Ensembl: ENSG00000135111
Vega: OTTHUMG00000169586
Pharos: O15119(Tbio)
UniProt: O15119 A0A024RBL6
Structure
LinkDB
Position
12:complement(114670255..114684175)
AA seq 743 aa
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGAL
AKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRG
TEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM
PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQT
ILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA
KGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAASTV
GTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAE
RPRDSGRLDKASPDSRHSPATISSSTRGLGAEERRSPVREGTAPAKVEEARALPGKEAFA
PLTVQTDAAAAHLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPSQFAMGGAFSSMAAAGMG
PLLATVSGASTGVSGLDSTAMASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSL
FPYPYTYMAAAAAASSAAASSSVHRHPFLNLNTMRPRLRYSPYSIPVPVPDGSSLLTTAL
PSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSMSLSPKLCAEKEAATSE
LQSIQRLVSGLEAKPDRSRSASP
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgagcctctccatgagagatccggtcattcctgggacaagcatggcctaccatccgttc
ctacctcaccgggcgccggacttcgccatgagcgcggtgctgggtcaccagccgccgttc
ttccccgcgctgacgctgcctcccaacggcgcggcggcgctctcgctgccgggcgccctg
gccaagccgatcatggatcaattggtgggggcggccgagaccggcatcccgttctcctcc
ctggggccccaggcgcatctgaggcctttgaagaccatggagcccgaagaagaggtggag
gacgaccccaaggtgcacctggaggctaaagaactttgggatcagtttcacaagcggggc
accgagatggtcattaccaagtcgggaaggcgaatgtttcctccatttaaagtgagatgt
tctgggctggataaaaaagccaaatacattttattgatggacattatagctgctgatgac
tgtcgttataaatttcacaattctcggtggatggtggctggtaaggccgaccccgaaatg
ccaaagaggatgtacattcacccggacagccccgctactggggaacagtggatgtccaaa
gtcgtcactttccacaaactgaaactcaccaacaacatttcagacaaacatggatttact
ttggccttcccaagtgatcacgctacgtggcaggggaattatagttttggtactcagact
atattgaactccatgcacaaataccagccccggttccacattgtaagagccaatgacatc
ttgaaactcccttatagtacatttcggacatacttgttccccgaaactgaattcatcgct
gtgactgcataccagaatgataagataacccagttaaaaatagacaacaacccttttgca
aaaggtttccgggacactggaaatggccgaagagaaaaaagaaaacagctcaccctgcag
tccatgagggtgtttgatgaaagacacaaaaaggagaatgggacctctgatgagtcctcc
agtgaacaagcagctttcaactgcttcgcccaggcttcttctccagccgcctccactgta
gggacatcgaacctcaaagatttatgtcccagcgagggtgagagcgacgccgaggccgag
agcaaagaggagcatggccccgaggcctgcgacgcggccaagatctccaccaccacgtcg
gaggagccctgccgtgacaagggcagccccgcggtcaaggctcaccttttcgctgctgag
cggccccgggacagcgggcggctggacaaagcgtcgcccgactcacgccatagccccgcc
accatctcgtccagcactcgcggcctgggcgcggaggagcgcaggagcccggttcgcgag
ggcacagcgccggccaaggtggaagaggcgcgcgcgctcccgggcaaggaggccttcgcg
ccgctcacggtgcagacggacgcggccgccgcgcacctggcccagggccccctgcctggc
ctcggcttcgccccgggcctggcgggccaacagttcttcaacgggcacccgctcttcctg
caccccagccagtttgccatggggggcgccttctccagcatggcggccgctggcatgggt
cccctcctggccacggtttctggggcctccaccggtgtctcgggcctggattccacggcc
atggcctctgccgctgcggcgcagggactgtccggggcgtccgcggccaccctgcccttc
cacctccagcagcacgtcctggcctctcagggcctggccatgtcccctttcggaagcctg
ttcccttacccctacacgtacatggccgcagcggcggccgcctcctctgcggcagcctcc
agctcggtgcaccgccaccccttcctcaatctgaacaccatgcgcccgcggctgcgctac
agcccctactccatcccggtgccggtcccggacggcagcagtctgctcaccaccgccctg
ccctccatggcggcggccgcggggcccctggacggcaaagtcgccgccctggccgccagc
ccggcctcggtggcagtggactcgggctctgaactcaacagccgctcctccacgctctcc
tccagctccatgtccttgtcgcccaaactctgcgcggagaaagaggcggccaccagcgaa
ctgcagagcatccagcggttggttagcggcttggaagccaagccggacaggtcccgcagc
gcgtccccgtag

DBGET integrated database retrieval system