KEGG   Homo sapiens (human): 722
Entry
722               CDS       T01001                                 

Gene name
C4BPA, C4BP, PRP
Definition
(RefSeq) complement component 4 binding protein alpha
  KO
K04002  complement component 4 binding protein alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
Disease
H00106  Complement regulatory protein defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    722 (C4BPA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    722 (C4BPA)
SSDB
Motif
Pfam: Sushi C4bp_oligo C6
Other DBs
NCBI-GeneID: 722
NCBI-ProteinID: NP_000706
OMIM: 120830
HGNC: 1325
Ensembl: ENSG00000123838
Vega: OTTHUMG00000036173
Pharos: P04003(Tbio)
UniProt: P04003
LinkDB
Structure
PDB: 

Position
1q32.2
AA seq 597 aa
MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAA
PMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELR
NGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPD
IRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCR
KPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCI
NLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGC
EALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTP
SCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQC
KALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEW
ETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgcaccccccaaaaactccatctggggctcttcatagaaaaaggaaaatggcagcctgg
cccttctccaggctgtggaaagtctctgatccaattctcttccaaatgaccttgatcgct
gctctgttgcctgctgttcttggcaattgtggtcctccacccactttatcatttgctgcc
ccgatggatattacgttgactgagacacgcttcaaaactggaactactctgaaatacacc
tgcctccctggctacgtcagatcccattcaactcagacgcttacctgtaattctgatggc
gaatgggtgtataacaccttctgtatctacaaacgatgcagacacccaggagagttacgt
aatgggcaagtagagattaagacagatttatcttttggatcacaaatagaattcagctgt
tcagaaggatttttcttaattggctcaaccactagtcgttgtgaagtccaagatagagga
gttggctggagtcatcctctcccacaatgtgaaattgtcaagtgtaagcctcctccagac
atcaggaatggaaggcacagcggtgaagaaaatttctacgcatacggcttttctgtcacc
tacagctgtgacccccgcttctcactcttgggccatgcctccatttcttgcactgtggag
aatgaaacaataggtgtttggagaccaagccctcctacctgtgaaaaaatcacctgtcgc
aagccagatgtttcacatggggaaatggtctctggatttggacccatctataattacaaa
gacactattgtgtttaagtgccaaaaaggttttgttctcagaggcagcagtgtaattcat
tgtgatgctgatagcaaatggaatccttctcctcctgcttgtgagcccaatagttgtatt
aatttaccagacattccacatgcttcctgggaaacatatcctaggccgacaaaagaggat
gtgtatgttgttgggactgtgttaaggtaccgctgtcatcctggctacaaacccactaca
gatgagcctacgactgtgatttgtcagaaaaatttgagatggaccccataccaaggatgt
gaggcgttatgttgccctgaaccaaagctaaataatggtgaaatcactcaacacaggaaa
agtcgtcctgccaatcactgtgtttatttctatggagatgagatttcattttcatgtcat
gagaccagtaggttttcagctatatgccaaggagatggcacgtggagtccccgaacacca
tcatgtggagacatttgcaattttcctcctaaaattgcccatgggcattataaacaatct
agttcatacagctttttcaaagaagagattatatatgaatgtgataaaggctacattctg
gtcggacaggcgaaactctcctgcagttattcacactggtcagctccagcccctcaatgt
aaagctctgtgtcggaaaccagaattagtgaatggaaggttgtctgtggataaggatcag
tatgttgagcctgaaaatgtcaccatccaatgtgattctggctatggtgtggttggtccc
caaagtatcacttgctctgggaacagaacctggtacccagaggtgcccaagtgtgagtgg
gagacccccgaaggctgtgaacaagtgctcacaggcaaaagactcatgcagtgtctccca
aacccagaggatgtgaaaatggccctggaggtatataagctgtctctggaaattgaacaa
ctggaactacagagagacagcgcaagacaatccactttggataaagaactataa

KEGG   Homo sapiens (human): 725
Entry
725               CDS       T01001                                 

Gene name
C4BPB, C4BP
Definition
(RefSeq) complement component 4 binding protein beta
  KO
K04003  complement component 4 binding protein beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
Disease
H00106  Complement regulatory protein defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    725 (C4BPB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    725 (C4BPB)
SSDB
Motif
Pfam: Sushi IKKbetaNEMObind
Other DBs
NCBI-GeneID: 725
NCBI-ProteinID: NP_000707
OMIM: 120831
HGNC: 1328
Ensembl: ENSG00000123843
Vega: OTTHUMG00000036035
Pharos: P20851(Tbio)
UniProt: P20851
LinkDB
Position
1q32.1
AA seq 252 aa
MFFWCACCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLVGKKT
LFCNASKEWDNTTTECRLGHCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRSQ
CLEDHTWAPPFPICKSRDCDPPGNPVHGYFEGNNFTLGSTISYYCEDRYYLVGVQEQQCV
DGEWSSALPVCKLIQEAPKPECEKALLAFQESKNLCEAMENFMQQLKESGMTMEELKYSL
ELKKAELKAKLL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgtttttttggtgtgcgtgctgtcttatggttgcgtggcgagtttctgcttcagatgca
gagcactgtccagagcttcctccagtggacaatagcatatttgtcgcaaaggaggtggaa
ggacagattctggggacttacgtttgtatcaagggctaccacctggtaggaaagaagacc
cttttttgcaatgcctctaaggagtgggataacaccactactgagtgccgcttgggccac
tgtcctgatcctgtgctggtgaatggagagttcagttcttcagggcctgtgaatgtaagt
gacaaaatcacgtttatgtgcaatgaccactacatcctcaagggcagcaatcggagccag
tgtctagaggaccacacctgggcacctccctttcccatctgcaaaagtagggactgtgac
cctcctgggaatccagttcatggctattttgaaggaaataacttcaccttaggatccacc
attagttattactgtgaagacaggtactacttagtgggcgtgcaggagcagcaatgcgtt
gatggggagtggagcagtgcacttccagtctgcaagttgatccaggaagctcccaaacca
gagtgtgagaaggcacttcttgcctttcaggagagtaagaacctctgcgaagccatggag
aactttatgcaacaattaaaggaaagtggcatgacaatggaggagctaaaatattctctg
gagctgaagaaagctgagttgaaggcaaaattgttgtaa

DBGET integrated database retrieval system