KEGG   Homo sapiens (human): 7272
Entry
7272              CDS       T01001                                 
Symbol
TTK, CT96, ESK, MPH1, MPS1, MPS1L1, PYT
Name
(RefSeq) TTK protein kinase
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7272 (TTK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7272 (TTK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    7272 (TTK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     7272 (TTK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  TTK family
   7272 (TTK)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     7272 (TTK)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 APH Kdo ABC1 RIO1 Pkinase_fungal Mad3_BUB1_I_2 Mad3_BUB1_I TCAD9 DUF5898 Tubulin
Other DBs
NCBI-GeneID: 7272
NCBI-ProteinID: NP_003309
OMIM: 604092
HGNC: 12401
Ensembl: ENSG00000112742
Vega: OTTHUMG00000015088
Pharos: P33981(Tchem)
UniProt: P33981
Structure
LinkDB
Position
6:80004649..80042527
AA seq 857 aa
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSGSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFMKRQ
TSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ
KHTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQ
LSTPYGQPACFQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVF
QVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYM
VMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGML
KLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSL
GCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRI
SIPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE
SHNSSSSKTFEKKRGKK
NT seq 2574 nt   +upstreamnt  +downstreamnt
atggaatccgaggatttaagtggcagagaattgacaattgattccataatgaacaaagtg
agagacattaaaaataagtttaaaaatgaagaccttactgatgaactaagcttgaataaa
atttctgctgatactacagataactcgggaactgttaaccaaattatgatgatggcaaac
aacccagaggactggttgagtttgttgctcaaactagagaaaaacagtgttccgctaagt
gatgctcttttaaataaattgattggtcgttacagtcaagcaattgaagcgcttccccca
gataaatatggccaaaatgagagttttgctagaattcaagtgagatttgctgaattaaaa
gctattcaagagccagatgatgcacgtgactactttcaaatggccagagcaaactgcaag
aaatttgcttttgttcatatatcttttgcacaatttgaactgtcacaaggtaatgtcaaa
aaaagtaaacaacttcttcaaaaagctgtagaacgtggagcagtaccactagaaatgctg
gaaattgccctgcggaatttaaacctccaaaaaaagcagctgctttcagaggaggaaaag
aagaatttatcagcatctacggtattaactgcccaagaatcattttccggttcacttggg
catttacagaataggaacaacagttgtgattccagaggacagactactaaagccaggttt
ttatatggagagaacatgccaccacaagatgcagaaataggttaccggaattcattgaga
caaactaacaaaactaaacagtcatgcccatttggaagagtcccagttaaccttctaaat
agcccagattgtgatgtgaagacagatgattcagttgtaccttgttttatgaaaagacaa
acctctagatcagaatgccgagatttggttgtgcctggatctaaaccaagtggaaatgat
tcctgtgaattaagaaatttaaagtctgttcaaaatagtcatttcaaggaacctctggtg
tcagatgaaaagagttctgaacttattattactgattcaataaccctgaagaataaaacg
gaatcaagtcttctagctaaattagaagaaactaaagagtatcaagaaccagaggttcca
gagagtaaccagaaacagtggcaatctaagagaaagtcagagtgtattaaccagaatcct
gctgcatcttcaaatcactggcagattccggagttagcccgaaaagttaatacagagcag
aaacataccacttttgagcaacctgtcttttcagtttcaaaacagtcaccaccaatatca
acatctaaatggtttgacccaaaatctatttgtaagacaccaagcagcaataccttggat
gattacatgagctgttttagaactccagttgtaaagaatgactttccacctgcttgtcag
ttgtcaacaccttatggccaacctgcctgtttccagcagcaacagcatcaaatacttgcc
actccacttcaaaatttacaggttttagcatcttcttcagcaaatgaatgcatttcggtt
aaaggaagaatttattccatattaaagcagataggaagtggaggttcaagcaaggtattt
caggtgttaaatgaaaagaaacagatatatgctataaaatatgtgaacttagaagaagca
gataaccaaactcttgatagttaccggaacgaaatagcttatttgaataaactacaacaa
cacagtgataagatcatccgactttatgattatgaaatcacggaccagtacatctacatg
gtaatggagtgtggaaatattgatcttaatagttggcttaaaaagaaaaaatccattgat
ccatgggaacgcaagagttactggaaaaatatgttagaggcagttcacacaatccatcaa
catggcattgttcacagtgatcttaaaccagctaactttctgatagttgatggaatgcta
aagctaattgattttgggattgcaaaccaaatgcaaccagatacaacaagtgttgttaaa
gattctcaggttggcacagttaattatatgccaccagaagcaatcaaagatatgtcttcc
tccagagagaatgggaaatctaagtcaaagataagccccaaaagtgatgtttggtcctta
ggatgtattttgtactatatgacttacgggaaaacaccatttcagcagataattaatcag
atttctaaattacatgccataattgatcctaatcatgaaattgaatttcccgatattcca
gagaaagatcttcaagatgtgttaaagtgttgtttaaaaagggacccaaaacagaggata
tccattcctgagctcctggctcatccatatgttcaaattcaaactcatccagttaaccaa
atggccaagggaaccactgaagaaatgaaatatgttctgggccaacttgttggtctgaat
tctcctaactccattttgaaagctgctaaaactttatatgaacactatagtggtggtgaa
agtcataattcttcatcctccaagacttttgaaaaaaaaaggggaaaaaaatga

DBGET integrated database retrieval system