KEGG   Homo sapiens (human): 729
Entry
729               CDS       T01001                                 
Symbol
C6
Name
(RefSeq) complement C6
  KO
K03995  complement component 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04810  Regulation of actin cytoskeleton
hsa05020  Prion disease
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06513  Complement cascade
  Element
N01490  Common pathway of complement cascade, MAC formation
N01505  Regulation of complement cascade, MAC inhibition
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    729 (C6)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    729 (C6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    729 (C6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    729 (C6)
  09164 Neurodegenerative disease
   05020 Prion disease
    729 (C6)
SSDB
Motif
Pfam: MACPF Sushi TSP_1 TSP1_spondin Ldl_recept_a Kazal_3
Other DBs
NCBI-GeneID: 729
NCBI-ProteinID: NP_000056
OMIM: 217050
HGNC: 1339
Ensembl: ENSG00000039537
Pharos: P13671(Tbio)
UniProt: P13671
Structure
LinkDB
Position
5:complement(41142116..41261469)
AA seq 934 aa
MARRSVLYFILLNALINKGQACFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQRCPINCLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAP
LVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
TRKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVQTAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRC
TTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCEKQSPDYKSNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQ
LYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQR
LYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQS
GSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggccagacgctctgtcttgtacttcatcctgctgaatgctctgatcaacaagggccaa
gcctgcttctgtgatcactatgcatggactcagtggaccagctgctcaaaaacttgcaat
tctggaacccagagcagacacagacaaatagtagtagataagtactaccaggaaaacttt
tgtgaacagatttgcagcaagcaggagactagagaatgtaactggcaaagatgccccatc
aactgcctcctgggagattttggaccatggtcagactgtgacccttgtattgaaaaacag
tctaaagttagatctgtcttgcgtcccagtcagtttgggggacagccatgcactgcgcct
ctggtagcctttcaaccatgcattccatctaagctctgcaaaattgaagaggctgactgc
aagaataaatttcgctgtgacagtggccgctgcattgccagaaagttagaatgcaatgga
gaaaatgactgtggagacaattcagatgaaagggactgtgggaggacaaaggcagtatgc
acacggaagtataatcccatccctagtgtacagttgatgggcaatgggtttcattttctg
gcaggagagcccagaggagaagtccttgataactctttcactggaggaatatgtaaaact
gtcaaaagcagtaggacaagtaatccataccgtgttccggccaatctggaaaatgtcggc
tttgaggtacaaactgcagaagatgacttgaaaacagatttctacaaggatttaacttct
cttggacacaatgaaaatcaacaaggctcattctcaagtcagggggggagctctttcagt
gtaccaattttttattcctcaaagagaagtgaaaatatcaaccataattctgccttcaaa
caagccattcaagcctctcacaaaaaggattctagttttattaggatccataaagtgatg
aaagtcttaaacttcacaacgaaagctaaagatctgcacctttctgatgtctttttgaaa
gcacttaaccatctgcctctagaatacaactctgctttgtacagccgaatattcgatgac
tttgggactcattacttcacctctggctccctgggaggcgtgtatgaccttctctatcag
tttagcagtgaggaactaaagaactcaggtttaaccgaggaagaagccaaacactgtgtc
aggattgaaacaaagaaacgcgttttatttgctaagaaaacaaaagtggaacataggtgc
accaccaacaagctgtcagagaaacatgaaggttcatttatacagggagcagagaaatcc
atatccctgattcgaggtggaaggagtgaatatggagcagctttggcatgggagaaaggg
agctctggtctggaggagaagacattttctgagtggttagaatcagtgaaggaaaatcct
gctgtgattgactttgagcttgcccccatcgtggacttggtaagaaacatcccctgtgca
gtgacaaaacggaacaacctcaggaaagctttgcaagagtatgcagccaagttcgatcct
tgccagtgtgctccatgccctaataatggccgacccaccctctcagggactgaatgtctg
tgtgtgtgtcagagtggcacctatggtgagaactgtgagaaacagtctccagattataaa
tccaatgcagtagacggacagtggggttgttggtcttcctggagtacctgtgatgctact
tataagagatcgagaacccgagaatgcaataatcctgccccccaacgaggagggaaacgc
tgtgagggggagaagcgacaagaggaagactgcacattttcaatcatggaaaacaatgga
caaccatgtatcaatgatgacgaagaaatgaaagaggtcgatcttcctgagatagaagca
gattccgggtgtcctcagccagttcctccagaaaatggatttatccggaatgaaaagcaa
ctatacttggttggagaagatgttgaaatttcatgccttactggctttgaaactgttgga
taccagtacttcagatgcttaccagacgggacctggagacaaggggatgtggaatgccaa
cggacggagtgcatcaagccagttgtgcaggaagtcctgacaattacaccatttcagaga
ttgtatagaattggtgaatccattgagctaacttgccccaaaggctttgttgttgctggg
ccatcaaggtacacatgccaggggaattcctggacaccacccatttcaaactctctcacc
tgtgaaaaagatactctaacaaaattaaaaggccattgtcagctgggacagaaacaatca
ggatctgaatgcatttgtatgtctccagaagaagactgtagccatcattcagaagatctc
tgtgtgtttgacacagactccaacgattactttacttcacccgcttgtaagtttttggct
gagaaatgtttaaataatcagcaactccattttctacatattggttcctgccaagacggc
cgccagttagaatggggtcttgaaaggacaagactttcatccaacagcacaaagaaagaa
tcctgtggctatgacacctgctatgactgggaaaaatgttcagcctccacttccaaatgt
gtctgcctattgcccccacagtgcttcaagggtggaaaccaactctactgtgtcaaaatg
ggatcatcaacaagtgagaaaacattgaacatctgtgaagtgggaactataagatgtgca
aacaggaagatggaaatactgcatcctggaaagtgtttggcctag

DBGET integrated database retrieval system