KEGG   Homo sapiens (human): 729
Entry
729               CDS       T01001                                 

Gene name
C6
Definition
(RefSeq) complement C6
  KO
K03995  complement component 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N00463  Alternative pathway of complement activation
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    729 (C6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    729 (C6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    729 (C6)
  09164 Neurodegenerative disease
   05020 Prion disease
    729 (C6)
SSDB
Motif
Pfam: MACPF Sushi TSP_1 TSP1_spondin Ldl_recept_a Kazal_3
Other DBs
NCBI-GeneID: 729
NCBI-ProteinID: NP_000056
OMIM: 217050
HGNC: 1339
Ensembl: ENSG00000039537
Vega: OTTHUMG00000094781
Pharos: P13671(Tbio)
UniProt: P13671
LinkDB
Structure
PDB: 
3T5O 4A5W 4E0S 6H04

Position
5p13.1
AA seq 934 aa
MARRSVLYFILLNALINKGQACFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQRCPINCLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAP
LVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
TRKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVQTAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRC
TTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCEKQSPDYKSNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQ
LYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQR
LYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQS
GSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggccagacgctctgtcttgtacttcatcctgctgaatgctctgatcaacaagggccaa
gcctgcttctgtgatcactatgcatggactcagtggaccagctgctcaaaaacttgcaat
tctggaacccagagcagacacagacaaatagtagtagataagtactaccaggaaaacttt
tgtgaacagatttgcagcaagcaggagactagagaatgtaactggcaaagatgccccatc
aactgcctcctgggagattttggaccatggtcagactgtgacccttgtattgaaaaacag
tctaaagttagatctgtcttgcgtcccagtcagtttgggggacagccatgcactgcgcct
ctggtagcctttcaaccatgcattccatctaagctctgcaaaattgaagaggctgactgc
aagaataaatttcgctgtgacagtggccgctgcattgccagaaagttagaatgcaatgga
gaaaatgactgtggagacaattcagatgaaagggactgtgggaggacaaaggcagtatgc
acacggaagtataatcccatccctagtgtacagttgatgggcaatgggtttcattttctg
gcaggagagcccagaggagaagtccttgataactctttcactggaggaatatgtaaaact
gtcaaaagcagtaggacaagtaatccataccgtgttccggccaatctggaaaatgtcggc
tttgaggtacaaactgcagaagatgacttgaaaacagatttctacaaggatttaacttct
cttggacacaatgaaaatcaacaaggctcattctcaagtcagggggggagctctttcagt
gtaccaattttttattcctcaaagagaagtgaaaatatcaaccataattctgccttcaaa
caagccattcaagcctctcacaaaaaggattctagttttattaggatccataaagtgatg
aaagtcttaaacttcacaacgaaagctaaagatctgcacctttctgatgtctttttgaaa
gcacttaaccatctgcctctagaatacaactctgctttgtacagccgaatattcgatgac
tttgggactcattacttcacctctggctccctgggaggcgtgtatgaccttctctatcag
tttagcagtgaggaactaaagaactcaggtttaaccgaggaagaagccaaacactgtgtc
aggattgaaacaaagaaacgcgttttatttgctaagaaaacaaaagtggaacataggtgc
accaccaacaagctgtcagagaaacatgaaggttcatttatacagggagcagagaaatcc
atatccctgattcgaggtggaaggagtgaatatggagcagctttggcatgggagaaaggg
agctctggtctggaggagaagacattttctgagtggttagaatcagtgaaggaaaatcct
gctgtgattgactttgagcttgcccccatcgtggacttggtaagaaacatcccctgtgca
gtgacaaaacggaacaacctcaggaaagctttgcaagagtatgcagccaagttcgatcct
tgccagtgtgctccatgccctaataatggccgacccaccctctcagggactgaatgtctg
tgtgtgtgtcagagtggcacctatggtgagaactgtgagaaacagtctccagattataaa
tccaatgcagtagacggacagtggggttgttggtcttcctggagtacctgtgatgctact
tataagagatcgagaacccgagaatgcaataatcctgccccccaacgaggagggaaacgc
tgtgagggggagaagcgacaagaggaagactgcacattttcaatcatggaaaacaatgga
caaccatgtatcaatgatgacgaagaaatgaaagaggtcgatcttcctgagatagaagca
gattccgggtgtcctcagccagttcctccagaaaatggatttatccggaatgaaaagcaa
ctatacttggttggagaagatgttgaaatttcatgccttactggctttgaaactgttgga
taccagtacttcagatgcttaccagacgggacctggagacaaggggatgtggaatgccaa
cggacggagtgcatcaagccagttgtgcaggaagtcctgacaattacaccatttcagaga
ttgtatagaattggtgaatccattgagctaacttgccccaaaggctttgttgttgctggg
ccatcaaggtacacatgccaggggaattcctggacaccacccatttcaaactctctcacc
tgtgaaaaagatactctaacaaaattaaaaggccattgtcagctgggacagaaacaatca
ggatctgaatgcatttgtatgtctccagaagaagactgtagccatcattcagaagatctc
tgtgtgtttgacacagactccaacgattactttacttcacccgcttgtaagtttttggct
gagaaatgtttaaataatcagcaactccattttctacatattggttcctgccaagacggc
cgccagttagaatggggtcttgaaaggacaagactttcatccaacagcacaaagaaagaa
tcctgtggctatgacacctgctatgactgggaaaaatgttcagcctccacttccaaatgt
gtctgcctattgcccccacagtgcttcaagggtggaaaccaactctactgtgtcaaaatg
ggatcatcaacaagtgagaaaacattgaacatctgtgaagtgggaactataagatgtgca
aacaggaagatggaaatactgcatcctggaaagtgtttggcctag

DBGET integrated database retrieval system