KEGG   Homo sapiens (human): 729
Entry
729               CDS       T01001                                 

Gene name
C6
Definition
(RefSeq) complement C6
  KO
K03995  complement component 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N00463  Alternative pathway of complement activation
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    729 (C6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    729 (C6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    729 (C6)
  09164 Neurodegenerative disease
   05020 Prion disease
    729 (C6)
SSDB
Motif
Pfam: MACPF Sushi TSP_1 TSP1_spondin Ldl_recept_a Kazal_3
Other DBs
NCBI-GeneID: 729
NCBI-ProteinID: NP_000056
OMIM: 217050
HGNC: 1339
Ensembl: ENSG00000039537
Vega: OTTHUMG00000094781
Pharos: P13671(Tbio)
UniProt: P13671
LinkDB
Structure
PDB: 
3T5O 4A5W 4E0S 6H04

Position
5p13.1
AA seq 934 aa
MARRSVLYFILLNALINKGQACFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQRCPINCLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAP
LVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
TRKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVQTAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRC
TTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCEKQSPDYKSNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQ
LYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQR
LYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQS
GSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggccagacgctctgtcttgtacttcatcctgctgaatgctctgatcaacaagggccaa
gcctgcttctgtgatcactatgcatggactcagtggaccagctgctcaaaaacttgcaat
tctggaacccagagcagacacagacaaatagtagtagataagtactaccaggaaaacttt
tgtgaacagatttgcagcaagcaggagactagagaatgtaactggcaaagatgccccatc
aactgcctcctgggagattttggaccatggtcagactgtgacccttgtattgaaaaacag
tctaaagttagatctgtcttgcgtcccagtcagtttgggggacagccatgcactgcgcct
ctggtagcctttcaaccatgcattccatctaagctctgcaaaattgaagaggctgactgc
aagaataaatttcgctgtgacagtggccgctgcattgccagaaagttagaatgcaatgga
gaaaatgactgtggagacaattcagatgaaagggactgtgggaggacaaaggcagtatgc
acacggaagtataatcccatccctagtgtacagttgatgggcaatgggtttcattttctg
gcaggagagcccagaggagaagtccttgataactctttcactggaggaatatgtaaaact
gtcaaaagcagtaggacaagtaatccataccgtgttccggccaatctggaaaatgtcggc
tttgaggtacaaactgcagaagatgacttgaaaacagatttctacaaggatttaacttct
cttggacacaatgaaaatcaacaaggctcattctcaagtcagggggggagctctttcagt
gtaccaattttttattcctcaaagagaagtgaaaatatcaaccataattctgccttcaaa
caagccattcaagcctctcacaaaaaggattctagttttattaggatccataaagtgatg
aaagtcttaaacttcacaacgaaagctaaagatctgcacctttctgatgtctttttgaaa
gcacttaaccatctgcctctagaatacaactctgctttgtacagccgaatattcgatgac
tttgggactcattacttcacctctggctccctgggaggcgtgtatgaccttctctatcag
tttagcagtgaggaactaaagaactcaggtttaaccgaggaagaagccaaacactgtgtc
aggattgaaacaaagaaacgcgttttatttgctaagaaaacaaaagtggaacataggtgc
accaccaacaagctgtcagagaaacatgaaggttcatttatacagggagcagagaaatcc
atatccctgattcgaggtggaaggagtgaatatggagcagctttggcatgggagaaaggg
agctctggtctggaggagaagacattttctgagtggttagaatcagtgaaggaaaatcct
gctgtgattgactttgagcttgcccccatcgtggacttggtaagaaacatcccctgtgca
gtgacaaaacggaacaacctcaggaaagctttgcaagagtatgcagccaagttcgatcct
tgccagtgtgctccatgccctaataatggccgacccaccctctcagggactgaatgtctg
tgtgtgtgtcagagtggcacctatggtgagaactgtgagaaacagtctccagattataaa
tccaatgcagtagacggacagtggggttgttggtcttcctggagtacctgtgatgctact
tataagagatcgagaacccgagaatgcaataatcctgccccccaacgaggagggaaacgc
tgtgagggggagaagcgacaagaggaagactgcacattttcaatcatggaaaacaatgga
caaccatgtatcaatgatgacgaagaaatgaaagaggtcgatcttcctgagatagaagca
gattccgggtgtcctcagccagttcctccagaaaatggatttatccggaatgaaaagcaa
ctatacttggttggagaagatgttgaaatttcatgccttactggctttgaaactgttgga
taccagtacttcagatgcttaccagacgggacctggagacaaggggatgtggaatgccaa
cggacggagtgcatcaagccagttgtgcaggaagtcctgacaattacaccatttcagaga
ttgtatagaattggtgaatccattgagctaacttgccccaaaggctttgttgttgctggg
ccatcaaggtacacatgccaggggaattcctggacaccacccatttcaaactctctcacc
tgtgaaaaagatactctaacaaaattaaaaggccattgtcagctgggacagaaacaatca
ggatctgaatgcatttgtatgtctccagaagaagactgtagccatcattcagaagatctc
tgtgtgtttgacacagactccaacgattactttacttcacccgcttgtaagtttttggct
gagaaatgtttaaataatcagcaactccattttctacatattggttcctgccaagacggc
cgccagttagaatggggtcttgaaaggacaagactttcatccaacagcacaaagaaagaa
tcctgtggctatgacacctgctatgactgggaaaaatgttcagcctccacttccaaatgt
gtctgcctattgcccccacagtgcttcaagggtggaaaccaactctactgtgtcaaaatg
ggatcatcaacaagtgagaaaacattgaacatctgtgaagtgggaactataagatgtgca
aacaggaagatggaaatactgcatcctggaaagtgtttggcctag

KEGG   Homo sapiens (human): 730
Entry
730               CDS       T01001                                 

Gene name
C7
Definition
(RefSeq) complement C7
  KO
K03996  complement component 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N00463  Alternative pathway of complement activation
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    730 (C7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    730 (C7)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    730 (C7)
  09164 Neurodegenerative disease
   05020 Prion disease
    730 (C7)
SSDB
Motif
Pfam: MACPF Kazal_3 Sushi TSP_1 Ldl_recept_a
Other DBs
NCBI-GeneID: 730
NCBI-ProteinID: NP_000578
OMIM: 217070
HGNC: 1346
Ensembl: ENSG00000112936
Vega: OTTHUMG00000150340
Pharos: P10643(Tbio)
UniProt: P10643 Q05CI3
LinkDB
Structure
PDB: 
6H04 2WCY

Position
5p13.1
AA seq 843 aa
MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgaaggtgataagcttattcattttggtgggatttataggagagttccaaagtttttca
agtgcctcctctccagtcaactgccagtgggacttctatgccccttggtcagaatgcaat
ggctgtaccaagactcagactcgcaggcggtcagttgctgtgtatgggcagtatggaggc
cagccttgtgttggaaatgcttttgaaacacagtcctgtgaacctacaagaggatgtcca
acagaggagggatgtggagagcgtttcaggtgcttttcaggtcagtgcatcagcaaatca
ttggtttgcaatggggattctgactgtgatgaagacagtgctgatgaagacagatgtgag
gactcagaaaggagaccttcctgtgatatcgataaacctcctcctaacatagaacttact
ggaaatggttacaatgaactcactggccagtttaggaacagagtcatcaataccaaaagt
tttggtggtcaatgtagaaaggtgtttagtggggatggaaaagatttctacaggctgagt
ggaaatgtcctgtcctatacattccaggtgaaaataaataatgattttaattatgaattt
tacaatagtacttggtcttatgtaaaacatacgtcgacagaacacacatcatctagtcgg
aagcgctccttttttagatcttcatcatcttcttcacgcagttatacttcacataccaat
gaaatccataaaggaaagagttaccaactgctggttgttgagaacactgttgaagtggct
cagttcattaataacaatccagaatttttacaacttgctgagccattctggaaggagctt
tcccacctcccctctctgtatgactacagtgcctaccgaagattaatcgaccagtacggg
acacattatctgcaatctgggtcgttaggaggagaatacagagttctattttatgtggac
tcagaaaaattaaaacaaaatgattttaattcagtcgaagaaaagaaatgtaaatcctca
ggttggcattttgtcgttaaattttcaagtcatggatgcaaggaactggaaaacgcttta
aaagctgcttcaggaacccagaacaatgtattgcgaggagaaccgttcatcagaggggga
ggtgcaggcttcatatctggccttagttacctagagctggacaatcctgctggaaacaaa
aggcgatattctgcctgggcagaatctgtgactaatcttcctcaagtcataaaacaaaag
ctgacacctttatatgagctggtaaaggaagtaccttgtgcctctgtgaaaaaactatac
ctgaaatgggctcttgaagagtatctggatgaatttgacccctgtcattgccggccttgt
caaaatggtggtttggctactgttgaggggacccattgtctgtgccattgcaaaccgtac
acatttggtgcggcgtgtgagcaaggagtcctcgtagggaatcaagcaggaggggttgat
ggaggttggagttgctggtcctcttggagcccctgtgtccaagggaagaaaacaagaagc
cgtgaatgcaataacccacctcccagtgggggtgggagatcctgcgttggagaaacgaca
gaaagcacacaatgcgaagatgaggagctggagcacttgaggttgcttgaaccacattgc
tttcctttgtctttggttccaacagaattctgtccatcacctcctgccttgaaagatgga
tttgttcaagatgaaggtacaatgtttcctgtggggaaaaatgtagtgtacacttgcaat
gaaggatactctcttattggaaacccagtggccagatgtggagaagatttacggtggctt
gttggggaaatgcattgtcagaaaattgcctgtgttctacctgtactgatggatggcata
cagagtcacccccaaaaacctttctacacagttggtgagaaggtgactgtttcctgttca
ggtggcatgtccttagaaggtccttcagcatttctctgtggctccagccttaagtggagt
cctgagatgaagaatgcccgctgtgtacaaaaagaaaatccgttaacacaggcagtgcct
aaatgtcagcgctgggagaaactgcagaattcaagatgtgtttgtaaaatgccctacgaa
tgtggaccttccttggatgtatgtgctcaagatgagagaagcaaaaggatactgcctctg
acagtttgcaagatgcatgttctccactgtcagggtagaaattacacccttactggtagg
gacagctgtactctgcctgcctcagctgagaaagcttgtggtgcctgcccactgtgggga
aaatgtgatgctgagagcagcaaatgtgtctgccgagaagcatcggagtgcgaggaagaa
gggtttagcatttgtgtggaagtgaacggcaaggagcagacgatgtctgagtgtgaggcg
ggcgctctgagatgcagagggcagagcatctctgtcaccagcataaggccttgtgctgcg
gaaacccagtag

KEGG   Homo sapiens (human): 731
Entry
731               CDS       T01001                                 

Gene name
C8A
Definition
(RefSeq) complement C8 alpha chain
  KO
K03997  complement component 8 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N00463  Alternative pathway of complement activation
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    731 (C8A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    731 (C8A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    731 (C8A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    731 (C8A)
  09164 Neurodegenerative disease
   05020 Prion disease
    731 (C8A)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP_1 TSP1_spondin
Other DBs
NCBI-GeneID: 731
NCBI-ProteinID: NP_000553
OMIM: 120950
HGNC: 1352
Ensembl: ENSG00000157131
Vega: OTTHUMG00000008306
Pharos: P07357(Tbio)
UniProt: P07357
LinkDB
Structure
PDB: 
2RD7 2QQH 3OJY 6H04

Position
1p32.2
AA seq 584 aa
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRH
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAH
FKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKA
KMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgtttgctgttgttttcttcatcttgtctttgatgacttgtcagcctggggtaactgca
caggagaaggtgaaccagagagtaagacgggcagctacacccgcagcagttacctgccag
ctgagcaactggtcagagtggacagattgctttccgtgccaggacaaaaagtaccgacac
cggagcctcttgcagccaaacaagtttgggggaaccatctgcagtggtgacatctgggat
caagccagctgctccagttctacaacttgtgtaaggcaagcacagtgtggacaggatttc
cagtgtaaggagacaggtcgctgcctgaaacgccaccttgtgtgtaatggagaccaggac
tgccttgatggctctgatgaggacgactgtgaagatgtcagggccattgacgaagactgc
agccagtatgaaccaattccaggatcacagaaggcagccttggggtacaatatcctgacc
caggaagatgctcagagtgtgtacgatgccagttattatgggggccagtgtgagacggta
tacaatggggaatggagggagcttcgatatgactccacctgtgaacgtctctactatgga
gatgatgagaaatactttcggaaaccctacaactttctgaagtaccactttgaagccctg
gcagatactggaatctcctcagagttttatgataatgcaaatgaccttctttccaaagtt
aaaaaagacaagtctgactcatttggagtgaccatcggcataggcccagccggcagccct
ttattggtgggtgtaggtgtatcccactcacaagacacttcattcttgaacgaattaaac
aagtataatgagaagaaattcattttcacaagaatcttcacaaaggtgcagactgcacat
tttaagatgaggaaggatgacattatgctggatgaaggaatgctgcagtcattaatggag
cttccagatcagtacaattatggcatgtatgccaagttcatcaatgactatggcacccat
tacatcacatctggatccatgggtggcatttatgaatatatcctggtgattgacaaagca
aaaatggaatcccttggtattaccagcagagatatcacgacatgttttggaggctccttg
ggcattcaatatgaagacaaaataaatgttggtggaggtttatcaggagaccattgtaaa
aaatttggaggtggcaaaactgaaagggccaggaaggccatggctgtggaagacattatt
tctcgggtgcgaggtggcagttctggctggagcggtggcttggcacagaacaggagcacc
attacataccgttcctgggggaggtcattaaagtataatcctgttgttatcgattttgag
atgcagcctatccacgaggtgctgcggcacacaagcctggggcctctggaggccaagcgc
cagaacctgcgccgcgccttggaccagtatctgatggaattcaatgcctgccgatgtggg
ccttgcttcaacaatggggtgcccatcctcgagggcaccagctgcaggtgccagtgccgc
ctgggtagcttgggtgctgcctgtgagcaaacacagacagaaggagccaaagcagatggg
agctggagttgctggagctcctggtctgtatgcagagcaggcatccaggaaaggagaaga
gagtgtgacaatccagcacctcagaatggaggggcctcgtgtccagggcggaaagtacag
acgcaggcttgctga

KEGG   Homo sapiens (human): 732
Entry
732               CDS       T01001                                 

Gene name
C8B, C82
Definition
(RefSeq) complement C8 beta chain
  KO
K03998  complement component 8 subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N00463  Alternative pathway of complement activation
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    732 (C8B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    732 (C8B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    732 (C8B)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    732 (C8B)
  09164 Neurodegenerative disease
   05020 Prion disease
    732 (C8B)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1
Other DBs
NCBI-GeneID: 732
NCBI-ProteinID: NP_000057
OMIM: 120960
HGNC: 1353
Ensembl: ENSG00000021852
Vega: OTTHUMG00000008305
Pharos: P07358(Tbio)
UniProt: P07358
LinkDB
Structure
PDB: 
3OJY 6H04

Position
1p32.2
AA seq 591 aa
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCGSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDF
ERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgaagaattccaggacatgggcttggagggcgccggtggagctatttcttctctgtgct
gccctgggctgtctcagtttgcctggctccagaggtgaaaggccacattcctttgggtca
aatgcagtcaacaagagctttgctaagagcagacagatgcggagtgtggatgttaccctg
atgcccattgattgtgagctgtctagttggtcctcttggaccacatgtgacccctgtcag
aagaaaaggtacaggtatgcctacttgctccagccctctcagttccatggggaaccgtgc
aacttctctgacaaggaagtcgaagactgtgttaccaacagaccatgcggaagtcaagtg
cgatgtgaaggctttgtgtgtgcacagacaggaaggtgtgtaaaccgcagacttctttgc
aatggggacaatgactgtggagaccagtcagatgaagcaaactgtagaaggatttataaa
aaatgtcagcatgaaatggaccaatactggggaattggcagtctggccagtgggataaat
ttgttcacaaacagttttgagggcccagttcttgatcacaggtattatgcaggtggatgc
tccccgcattacatcctgaacacgaggtttaggaagccctacaatgtggaaagctacacg
ccacagacccaaggcaaatacgaattcatattaaaagagtatgaatcatactcagatttt
gaacgcaatgtcacagagaaaatggcaagcaagtctggtttcagttttggttttaaaata
cctggaatatttgaacttggcatcagtagtcaaagtgatcgaggcaaacactatattagg
agaaccaaacgattctctcatactaaaagcgtatttctgcatgcacgctctgaccttgaa
gtagcacattacaagctgaaacccagaagcctcatgctccattacgagttccttcagaga
gttaagcggctgcccctggagtacagctacggggaatacagagatctcttccgtgatttt
gggacccactacatcacagaggctgtgcttgggggcatttatgaatacaccctcgttatg
aacaaagaggccatggagagaggagattatactcttaacaacgtccatgcctgtgccaaa
aatgattttaaaattggtggtgccattgaagaggtctacgtcagtctgggtgtgtctgta
ggcaaatgcagaggtattctgaatgaaataaaagacagaaacaagagggacaccatggtg
gaggacttggtggtcctggtacgaggaggggcaagtgagcacatcaccaccctggcatac
caggagctgccgacggcggacctgatgcaggagtggggagacgctgtgcagtacaaccca
gccatcatcaaagttaaggtggagcctctgtatgaactagtgacagccacagattttgcc
tattccagcacagtgaggcagaacatgaagcaggcactggaggagttccagaaggaagtt
agttcctgccactgtgctccctgccaaggaaatggagtccctgtcctgaaaggatcacgc
tgtgactgcatctgtcctgttggatcccaaggcctagcctgtgaggtctcctatcggaag
aatacccccattgatgggaagtggaattgctggtcaaattggtcttcatgctctggaaga
cgtaagacaagacaaaggcagtgtaacaatccacctcctcaaaatgggggtagcccctgt
tcaggccctgcttcagaaacacttgactgctcctag

KEGG   Homo sapiens (human): 733
Entry
733               CDS       T01001                                 

Gene name
C8G, C8C
Definition
(RefSeq) complement C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N00463  Alternative pathway of complement activation
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    733 (C8G)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    733 (C8G)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    733 (C8G)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    733 (C8G)
  09164 Neurodegenerative disease
   05020 Prion disease
    733 (C8G)
SSDB
Motif
Pfam: Lipocalin
Other DBs
NCBI-GeneID: 733
NCBI-ProteinID: NP_000597
OMIM: 120930
HGNC: 1354
Ensembl: ENSG00000176919
Vega: OTTHUMG00000020955
Pharos: P07360(Tbio)
UniProt: P07360
LinkDB
Structure
PDB: 

Position
9q34.3
AA seq 202 aa
MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAC
RFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDAR
GAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF
YFPKYGFCEAADQFHVLDEVRR
NT seq 609 nt   +upstreamnt  +downstreamnt
atgctgccccctgggactgcgaccctcttgactctgctcctggcagctggctcgctgggc
cagaagcctcagaggccacgccggcccgcatcccccatcagcaccatccagcccaaggcc
aattttgatgctcagcagtttgcagggacctggctccttgtggctgtgggctccgcttgc
cgtttcctgcaggagcagggccaccgggccgaggccaccacactgcatgtggctccccag
ggcacagccatggctgtcagtaccttccgaaagctggatgggatctgctggcaggtgcgc
cagctctatggagacacaggggtcctcggccgcttcctgcttcaagcccgagacgcccga
ggggctgtgcacgtggttgtcgctgagaccgactaccagagtttcgctgtcctgtacctg
gagcgggcggggcagctgtcagtgaagctctacgcccgctcgctccctgtgagcgactcg
gtcctgagtgggtttgagcagcgggtccaggaggcccacctgactgaggaccagatcttc
tacttccccaagtacggcttctgcgaggctgcagaccagttccacgtcctggacgaagtg
aggaggtga

KEGG   Homo sapiens (human): 735
Entry
735               CDS       T01001                                 

Gene name
C9, ARMD15, C9D
Definition
(RefSeq) complement C9
  KO
K04000  complement component 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N00463  Alternative pathway of complement activation
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    735 (C9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    735 (C9)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    735 (C9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    735 (C9)
  09164 Neurodegenerative disease
   05020 Prion disease
    735 (C9)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1 eIF-5_eIF-2B
Other DBs
NCBI-GeneID: 735
NCBI-ProteinID: NP_001728
OMIM: 120940
HGNC: 1358
Ensembl: ENSG00000113600
Vega: OTTHUMG00000094767
Pharos: P02748(Tbio)
UniProt: P02748
LinkDB
Structure
PDB: 
6DLW 6H04 5FMW

Position
5p13.1
AA seq 559 aa
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCN
GDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAIS
LKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIY
VLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSEN
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLV
PVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACE
ISKQKISEGLPALEFPNEK
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtcagcctgccggagctttgcagttgcaatctgcattttagaaataagcatcctcaca
gcacagtacacgaccagttatgacccagagctaacagaaagcagtggctctgcatcacac
atagactgcagaatgagcccctggagtgaatggtcacaatgcgatccttgtctcagacaa
atgtttcgttcaagaagcattgaggtctttggacaatttaatgggaaaagatgcaccgac
gctgtgggagacagacgacagtgtgtgcccacagagccctgtgaggatgctgaggatgac
tgcggaaatgactttcaatgcagtacaggcagatgcataaagatgcgacttcggtgtaat
ggtgacaatgactgcggagacttttcagatgaggatgattgtgaaagtgagccccgtccc
ccctgcagagacagagtggtagaagagtctgagctggcacgaacagcaggctatgggatc
aacattttagggatggatcccctaagcacaccttttgacaatgagttctacaatggactc
tgtaaccgggatcgggatggaaacactctgacatactaccgaagaccttggaacgtggct
tctttgatctatgaaaccaaaggcgagaaaaatttcagaaccgaacattacgaagaacaa
attgaagcatttaaaagtatcatccaagagaagacatcaaattttaatgcagctatatct
ctaaaatttacacccactgaaacaaataaagctgaacaatgttgtgaggaaacagcctcc
tcaatttctttacatggcaagggtagttttcggttttcatattccaaaaatgaaacttac
caactatttttgtcatattcttcaaagaaggaaaaaatgtttctgcatgtgaaaggagaa
attcatctgggaagatttgtaatgagaaatcgcgatgttgtgctcacaacaacttttgtg
gatgatataaaagctttgccaactacctatgaaaagggagaatattttgcctttttggaa
acctatggaactcactacagtagctctgggtctctaggaggactctatgaactaatatat
gttttggataaagcttccatgaagcggaaaggtgttgaactaaaagacataaagagatgc
cttgggtatcatctggatgtatctctggctttctctgaaatctctgttggagctgaattt
aataaagatgattgtgtaaagaggggagagggtagagctgtaaacatcaccagtgaaaac
ctcatagatgatgttgtttcactcataagaggtggaaccagaaaatatgcatttgaactg
aaagaaaagcttctccgaggaaccgtgattgatgtgactgactttgtcaactgggcctct
tccataaatgatgctcctgttctcattagtcaaaaactgtctcctatatataatctggtt
ccagtgaaaatgaaaaatgcacacctaaagaaacaaaacttggaaagagccattgaagac
tatatcaatgaatttagtgtaagaaaatgccacacatgccaaaatggaggtacagtgatt
ctaatggatggaaagtgtttgtgtgcctgcccattcaaatttgagggaattgcctgtgaa
atcagtaaacaaaaaatttctgaaggattgccagccctagagttccccaatgaaaaatag

DBGET integrated database retrieval system