Homo sapiens (human): 7295 Help Entry 7295              CDS       T01001                                  Symbol TXN, TRDX, TRX, TRX1, TXN1, Trx80 Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism hsa  Homo sapiens (human) Pathway hsa04621   NOD-like receptor signaling pathway hsa05012   Parkinson disease hsa05132   Salmonella infection hsa05418   Fluid shear stress and atherosclerosis Network nt06463  Parkinson disease   Element N01059   Mutation-inactivated DJ1 to KEAP1-NRF2 signaling pathway N01417   Paraquat to FAS-JNK signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     7295 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     7295 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     7295 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     7295 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hsa03110]     7295 (TXN) Chaperones and folding catalysts [BR:hsa03110]  Protein folding catalysts   Protein disulfide isomerase    7295 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 Thioredoxin_9 AhpC-TSA Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  7295 NCBI-ProteinID:  NP_003320 OMIM:  187700 HGNC:  12435 Ensembl:  ENSG00000136810 UniProt:  P10599 H9ZYJ2 Structure PDBPDBj LinkDB All DBs Position 9:complement(110243810..110256507) Genome browser AA seq 105 aa AA seqDB search MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagactgcttttcaggaagccttggacgctgcaggtgat aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattccctctctgaaaagtattccaacgtgatattccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaacattccagtttttt aagaagggacaaaaggtgggtgaattttctggagccaataaggaaaagcttgaagccacc attaatgaattagtctaa

DBGET integrated database retrieval system