KEGG   Homo sapiens (human): 7295Help
Entry
7295              CDS       T01001                                 

Gene name
TXN, TRDX, TRX, TRX1
Definition
(RefSeq) thioredoxin
  KO
K03671  thioredoxin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7295 (TXN)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7295 (TXN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    7295 (TXN)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   7295 (TXN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 Thioredoxin_7 OST3_OST6 Thioredoxin_9 Glutaredoxin AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 7295
NCBI-ProteinID: NP_003320
OMIM: 187700
HGNC: 12435
Ensembl: ENSG00000136810
Vega: OTTHUMG00000020480
Pharos: P10599(Tchem)
UniProt: P10599 H9ZYJ2
LinkDB All DBs
Structure
PDB: 

Position
9q31.3
AA seq 105 aa AA seqDB search
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVD
DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcagatcgagagcaagactgcttttcaggaagccttggacgctgcaggtgat
aaacttgtagtagttgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct
ttctttcattccctctctgaaaagtattccaacgtgatattccttgaagtagatgtggat
gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaacattccagtttttt
aagaagggacaaaaggtgggtgaattttctggagccaataaggaaaagcttgaagccacc
attaatgaattagtctaa

DBGET integrated database retrieval system