KEGG   Homo sapiens (human): 7316
Entry
7316              CDS       T01001                                 
Symbol
UBC, HMG20
Name
(RefSeq) ubiquitin C
  KO
K08770  ubiquitin C
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04137  Mitophagy - animal
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01027  UCHL1-mediated hydrolysis
N01028  Mutation-inactivated UCHL1 to UCHL1-mediated hydrolysis
N01029  26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7316 (UBC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    7316 (UBC)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    7316 (UBC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    7316 (UBC)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7316 (UBC)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7316 (UBC)
   05022 Pathways of neurodegeneration - multiple diseases
    7316 (UBC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7316 (UBC)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   7316 (UBC)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD Rad60-SLD_2 DUF2604 Ubiquitin_5
Other DBs
NCBI-GeneID: 7316
NCBI-ProteinID: NP_066289
OMIM: 191340
HGNC: 12468
Ensembl: ENSG00000150991
Pharos: P0CG48(Tbio)
UniProt: P0CG48
Structure
LinkDB
Position
12:complement(124911646..124914650)
AA seq 685 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ
QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE
NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED
GRTLSDYNIQKESTLHLVLRLRGGV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgcagatcttcgtgaagactctgactggtaagaccatcaccctcgaggttgagcccagt
gacaccatcgagaatgtcaaggcaaagatccaagataaggaaggcatccctcctgaccag
cagaggctgatctttgctggaaaacagctggaagatgggcgcaccctgtctgactacaac
atccagaaagagtccaccctgcacctggtgctccgtctcagaggtgggatgcaaatcttc
gtgaagacactcactggcaagaccatcacccttgaggtcgagcccagtgacaccatcgag
aacgtcaaagcaaagatccaggacaaggaaggcattcctcctgaccagcagaggttgatc
tttgccggaaagcagctggaagatgggcgcaccctgtctgactacaacatccagaaagag
tctaccctgcacctggtgctccgtctcagaggtgggatgcagatcttcgtgaagaccctg
actggtaagaccatcaccctcgaggtggagcccagtgacaccatcgagaatgtcaaggca
aagatccaagataaggaaggcattcctcctgatcagcagaggttgatctttgccggaaaa
cagctggaagatggtcgtaccctgtctgactacaacatccagaaagagtccaccttgcac
ctggtactccgtctcagaggtgggatgcaaatcttcgtgaagacactcactggcaagacc
atcacccttgaggtcgagcccagtgacactatcgagaacgtcaaagcaaagatccaagac
aaggaaggcattcctcctgaccagcagaggttgatctttgccggaaagcagctggaagat
gggcgcaccctgtctgactacaacatccagaaagagtctaccctgcacctggtgctccgt
ctcagaggtgggatgcagatcttcgtgaagaccctgactggtaagaccatcactctcgaa
gtggagccgagtgacaccattgagaatgtcaaggcaaagatccaagacaaggaaggcatc
cctcctgaccagcagaggttgatctttgccggaaaacagctggaagatggtcgtaccctg
tctgactacaacatccagaaagagtccaccttgcacctggtgctccgtctcagaggtggg
atgcagatcttcgtgaagaccctgactggtaagaccatcactctcgaggtggagccgagt
gacaccattgagaatgtcaaggcaaagatccaagacaaggaaggcatccctcctgaccag
cagaggttgatctttgctgggaaacagctggaagatggacgcaccctgtctgactacaac
atccagaaagagtccaccctgcacctggtgctccgtcttagaggtgggatgcagatcttc
gtgaagaccctgactggtaagaccatcactctcgaagtggagccgagtgacaccattgag
aatgtcaaggcaaagatccaagacaaggaaggcatccctcctgaccagcagaggttgatc
tttgctgggaaacagctggaagatggacgcaccctgtctgactacaacatccagaaagag
tccaccctgcacctggtgctccgtcttagaggtgggatgcagatcttcgtgaagaccctg
actggtaagaccatcactctcgaagtggagccgagtgacaccattgagaatgtcaaggca
aagatccaagacaaggaaggcatccctcctgaccagcagaggttgatctttgctgggaaa
cagctggaagatggacgcaccctgtctgactacaacatccagaaagagtccaccctgcac
ctggtgctccgtctcagaggtgggatgcaaatcttcgtgaagaccctgactggtaagacc
atcaccctcgaggtggagcccagtgacaccatcgagaatgtcaaggcaaagatccaagat
aaggaaggcatccctcctgatcagcagaggttgatctttgctgggaaacagctggaagat
ggacgcaccctgtctgactacaacatccagaaagagtccactctgcacttggtcctgcgc
ttgagggggggtgtctaa

DBGET integrated database retrieval system