KEGG   Homo sapiens (human): 7517
Entry
7517              CDS       T01001                                 
Symbol
XRCC3, CMM6
Name
(RefSeq) X-ray repair cross complementing 3
  KO
K10880  DNA-repair protein XRCC3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Disease
H00038  Melanoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    7517 (XRCC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7517 (XRCC3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     7517 (XRCC3)
SSDB
Motif
Pfam: Rad51 AAA_25 RecA DnaB_C ATPase RNA_pol_A_CTD
Other DBs
NCBI-GeneID: 7517
NCBI-ProteinID: NP_001093588
OMIM: 600675
HGNC: 12830
Ensembl: ENSG00000126215
Pharos: O43542(Tbio)
UniProt: O43542 Q53XC8
LinkDB
Position
14:complement(103697617..103715451)
AA seq 346 aa
MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGS
SILTALQLHQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQL
CLAVQFPRQHGGLEAGAVYICTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIF
IEHVADVDTLLECVNKKVPVLLSRGMARLVVIDSVAAPFRCEFDSQASAPRARHLQSLGA
TLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADR
LREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggatttggatctactggacctgaatcccagaattattgctgcaattaagaaagccaaa
ctgaaatcggtaaaggaggttttacacttttctggaccagacttgaagagactgaccaac
ctctccagccccgaggtctggcacttgctgagaacggcctccttacacttgcggggaagc
agcatccttacagcactgcagctgcaccagcagaaggagcggttccccacgcagcaccag
cgcctgagcctgggctgcccggtgctggacgcgctgctccgcggtggcctgcccctggac
ggcatcactgagctggccggacgcagctcggcagggaagacccagctggcgctgcagctc
tgcctggctgtgcagttcccgcggcagcacggaggcctggaggctggagccgtctacatc
tgcacggaagacgccttcccgcacaagcgcctgcagcagctcatggcccagcagccgcgg
ctgcgcactgacgttccaggagagctgcttcagaagctccgatttggcagccagatcttc
atcgagcacgtggccgatgtggacaccttgttggagtgtgtgaataagaaggtccccgta
ctgctgtctcggggcatggctcgcctggtggtcatcgactcggtggcagccccattccgc
tgtgaatttgacagccaggcctccgcccccagggccaggcatctgcagtccctgggggcc
acgctgcgtgagctgagcagtgccttccagagccctgtgctgtgcatcaaccaggtgaca
gaggccatggaggagcagggcgcagcacacgggccgctggggttctgggacgaacgtgtt
tccccagcccttggcataacctgggctaaccagctcctggtgagactgctggctgaccgg
ctccgcgaggaagaggctgccctcggctgcccagcccggaccctgcgggtgctctctgcc
ccccacctgcccccctcctcctgttcctacacgatcagtgccgaaggggtgcgagggaca
cctgggacccagtcccactga

DBGET integrated database retrieval system