KEGG   Homo sapiens (human): 79017
Entry
79017             CDS       T01001                                 
Symbol
GGCT, C7orf24, CRF21, GCTG, GGC
Name
(RefSeq) gamma-glutamylcyclotransferase
  KO
K00682  gamma-glutamylcyclotransferase [EC:4.3.2.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    79017 (GGCT)
Enzymes [BR:hsa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.9  gamma-glutamylcyclotransferase
     79017 (GGCT)
SSDB
Motif
Pfam: AIG2_2 GGACT ChaC
Other DBs
NCBI-GeneID: 79017
NCBI-ProteinID: NP_076956
OMIM: 137170
HGNC: 21705
Ensembl: ENSG00000006625
Vega: OTTHUMG00000128593
Pharos: O75223(Tbio)
UniProt: O75223 A0A090N7V5
Structure
LinkDB
Position
7:complement(30496621..30504829)
AA seq 188 aa
MANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKT
SQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEI
TCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDII
KKGETQTL
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccaactcgggctgcaaggacgtcacgggtccagatgaggagagttttctgtacttt
gcctacggcagcaacctgctgacagagaggatccacctccgaaacccctcggcggcgttc
ttctgtgtggcccgcctgcaggattttaagcttgactttggcaattcccaaggcaaaaca
agtcaaacttggcatggagggatagccaccatttttcagagtcctggcgatgaagtgtgg
ggagtagtatggaaaatgaacaaaagcaatttaaattctctggatgagcaagaaggggtt
aaaagtggaatgtatgttgtaatagaagttaaagttgcaactcaagaaggaaaagaaata
acctgtcgaagttatctgatgacaaattacgaaagtgctcccccatccccacagtataaa
aagattatttgcatgggtgcaaaagaaaatggtttgccgctggagtatcaagagaagtta
aaagcaatagaaccaaatgactatacaggaaaggtctcagaagaaattgaagacatcatc
aaaaagggggaaacacaaactctttag

DBGET integrated database retrieval system