KEGG   Homo sapiens (human): 79026
Entry
79026             CDS       T01001                                 
Symbol
AHNAK, AHNAKRS, PM227
Name
(RefSeq) AHNAK nucleoprotein
  KO
K23934  neuroblast differentiation-associated protein AHNAK
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01304  ANXA2-S100A10-regulated actin cytoskeleton
N01305  Salmonella SopB to ANXA2-S100A10-regulated actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    79026 (AHNAK)
SSDB
Motif
Pfam: DUF945 LmeA PDZ PDZ_2
Other DBs
NCBI-GeneID: 79026
NCBI-ProteinID: NP_001333374
OMIM: 103390
HGNC: 347
Ensembl: ENSG00000124942
Pharos: Q09666(Tbio)
UniProt: Q09666
Structure
LinkDB
Position
11:complement(62433544..62546806)
AA seq 5890 aa
MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATI
YFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVVLSGDDEE
YQRIYTTKIKPRLKSEDGVEGDLGETQSRTITVTRRVTAYTVDVTGREGAKDIDISSPEF
KIKIPRHELTEISNVDVETQSGKTVIRLPSGSGAASPTGSAVDIRAGAISASGPELQGAG
HSKLQVTMPGIKVGGSGVNVNAKGLDLGGRGGVQVPAVDISSSLGGRAVEVQGPSLESGD
HGKIKFPTMKVPKFGVSTGREGQTPKAGLRVSAPEVSVGHKGGKPGLTIQAPQLEVSVPS
ANIEGLEGKLKGPQITGPSLEGDLGLKGAKPQGHIGVDASAPQIGGSITGPSVEVQAPDI
DVQGPGSKLNVPKMKVPKFSVSGAKGEETGIDVTLPTGEVTVPGVSGDVSLPEIATGGLE
GKMKGTKVKTPEMIIQKPKISMQDVDLSLGSPKLKGDIKVSAPGVQGDVKGPQVALKGSR
VDIETPNLEGTLTGPRLGSPSGKTGTCRISMSEVDLNVAAPKVKGGVDVTLPRVEGKVKV
PEVDVRGPKVDVSAPDVEAHGPEWNLKMPKMKMPTFSTPGAKGEGPDVHMTLPKGDISIS
GPKVNVEAPDVNLEGLGGKLKGPDVKLPDMSVKTPKISMPDVDLHVKGTKVKGEYDVTVP
KLEGELKGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSVPGFKAEGPEVDVNLPKADVDI
SGPKIDVTAPDVSIEEPEGKLKGPKFKMPEMNIKVPKISMPDVDLHLKGPNVKGEYDVTM
PKVESEIKVPDVELKSAKMDIDVPDVEVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVN
LPKADVDISGPKVGVEVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHMKGPKV
KGEYDMTVPKLEGDLKGPKVDVSAPDVEMQGPDWNLKMPKIKMPKFSMPSLKGEGPEFDV
NLSKANVDISAPKVDTNAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPK
MKGNVDISAPKIEGEMQVPDVDIRGPKVDIKAPDVEGQGLDWSLKIPKMKMPKFSMPSLK
GEGPEVDVNLPKADVVVSGPKVDIEAPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDV
DLHLKGPKVKGDVDVSVPKVEGEMKVPDVEIKGPKMDIDAPDVEVQGPDWHLKMPKMKMP
KFSMPGFKGEGREVDVNLPKADIDVSGPKVDVEVPDVSLEGPEGKLKGPKFKMPEMHFKA
PKISMPDVDLNLKGPKLKGDVDVSLPEVEGEMKVPDVDIKGPKVDISAPDVDVHGPDWHL
KMPKVKMPKFSMPGFKGEGPEVDVKLPKADVDVSGPKMDAEVPDVNIEGPDAKLKGPKFK
MPEMSIKPQKISIPDVGLHLKGPKMKGDYDVTVPKVEGEIKAPDVDIKGPKVDINAPDVE
VHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDMNLPKADLGVSGPKVDIDVPDVNLEAPEG
KLKGPKFKMPSMNIQTHKISMPDVGLNLKAPKLKTDVDVSLPKVEGDLKGPEIDVKAPKM
DVNVGDIDIEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLHLKGPKVKGDMDVSVPKVEG
EMKVPDVDIKGPKVDIDAPDVEVHDPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKAD
IDVSGPSVDTDAPDLDIEGPEGKLKGSKFKMPKLNIKAPKVSMPDVDLNLKGPKLKGEID
ASVPELEGDLRGPQVDVKGPFVEAEVPDVDLECPDAKLKGPKFKMPEMHFKAPKISMPDV
DLHLKGPKVKGDADVSVPKLEGDLTGPSVGVEVPDVELECPDAKLKGPKFKMPDMHFKAP
KISMPDVDLHLKGPKVKGDVDVSVPKLEGDLTGPSVGVEVPDVELECPDAKLKGPKFKMP
EMHFKTPKISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVH
GPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVVVSGPKVDVEVPDVSLEGPEGKL
KGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSLPKLEGDLTGPSVDVEVPDVEL
ECPDAKLKGPKFKMPEMHFKTPKISMPDVNLNLKGPKVKGDMDVSVPKVEGEMKVPDVDI
RGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGPEVDVNLPKADVDVSGPKVD
VEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPKIKGDVDVSAPKLEGE
LKGPELDVKGPKLDADMPEVAVEGPNGKWKTPKFKMPDMHFKAPKISMPDLDLHLKSPKA
KGEVDVDVPKLEGDLKGPHVDVSGPDIDIEGPEGKLKGPKFKMPDMHFKAPNISMPDVDL
NLKGPKIKGDVDVSVPEVEGKLEVPDMNIRGPKVDVNAPDVQAPDWHLKMPKMKMPKFSM
PGFKAEGPEVDVNLPKADVDISGPKVDIEGPDVNIEGPEGKLKGPKLKMPEMNIKAPKIS
MPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDINAPDVGVQGPDWHLKMPK
VKMPKFSMPGFKGEGPDGDVKLPKADIDVSGPKVDIEGPDVNIEGPEGKLKGPKFKMPEM
NIKAPKISMPDIDLNLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGP
DWHLKMPKIKMPKISMPGFKGEGPDVDVNLPKADIDVSGPKVDVECPDVNIEGPEGKWKS
PKFKMPEMHFKTPKISMPDIDLNLTGPKIKGDVDVTGPKVEGDLKGPEVDLKGPKVDIDV
PDVNVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDVSGPKVDVEGPDVNIE
GPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLPKVEGDLKGPEVDIR
GPQVDIDVPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDI
DVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDM
KVPDVDIKGPKVDINAPDVDVQGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLPKADLD
VSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVS
LANVEGDLKGPALDIKGPKIDVDAPDIDIHGPDAKLKGPKLKMPDMHVNMPKISMPEIDL
NLKGSKLKGDVDVSGPKLEGDIKAPSLDIKGPEVDVSGPKLNIEGKSKKSRFKLPKFNFS
GSKVQTPEVDVKGKKPDIDITGPKVDINAPDVEVQGKVKGSKFKMPFLSISSPKVSMPDV
ELNLKSPKVKGDLDIAGPNLEGDFKGPKVDIKAPEVNLNAPDVDVHGPDWNLKMPKMKMP
KFSVSGLKAEGPDVAVDLPKGDINIEGPSMNIEGPDLNVEGPEGGLKGPKFKMPDMNIKA
PKISMPDIDLNLKGPKVKGDVDISLPKLEGDLKGPEVDIKGPKVDINAPDVDVHGPDWHL
KMPKVKMPKFSMPGFKGEGPEVDVTLPKADIDISGPNVDVDVPDVNIEGPDAKLKGPKFK
MPEMNIKAPKISMPDFDLNLKGPKMKGDVVVSLPKVEGDLKGPEVDIKGPKVDIDTPDIN
IEGSEGKFKGPKFKIPEMHLKAPKISMPDIDLNLKGPKVKGDVDVSLPKMEGDLKGPEVD
IKGPKVDINAPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKV
DIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEG
DMQVPDLDIKGPKVDINAPDVDVRGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLPKAD
LDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVD
VSLPKMEGDLKAPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEV
DVNLPKADIDVSGPKVDIDTPDIDIHGPEGKLKGPKFKMPDLHLKAPKISMPEVDLNLKG
PKMKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDVPDVDVQGPDWHLKMPKVKMPKFSMPG
FKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMP
DFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVK
MPKFSMPGFKGEGPDVDVTLPKADIEISGPKVDIDAPDVSIEGPDAKLKGPKFKMPEMNI
KAPKISMPDIDFNLKGPKVKGDVDVSLPKVEGDLKGPEIDIKGPSLDIDTPDVNIEGPEG
KLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVESDLKGPEVDIEGPEG
KLKGPKFKMPDVHFKSPQISMSDIDLNLKGPKIKGDMDISVPKLEGDLKGPKVDVKGPKV
GIDTPDIDIHGPEGKLKGPKFKMPDLHLKAPKISMPEVDLNLKGPKVKGDMDISLPKVEG
DLKGPEVDIRDPKVDIDVPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKAD
IDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMSIKAPKISMPDIDLNLKGPKVKGDVD
VTLPKVEGDLKGPEADIKGPKVDINTPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDV
DVSLPKADIDVSGPKVDVDIPDVNIEGPDAKLKGPKFKMPEINIKAPKISIPDVDLDLKG
PKVKGDFDVSVPKVEGTLKGPEVDLKGPRLDFEGPDAKLSGPSLKMPSLEISAPKVTAPD
VDLHLKAPKIGFSGPKLEGGEVDLKGPKVEAPSLDVHMDSPDINIEGPDVKIPKFKKPKF
GFGAKSPKADIKSPSLDVTVPEAELNLETPEISVGGKGKKSKFKMPKIHMSGPKIKAKKQ
GFDLNVPGGEIDASLKAPDVDVNIAGPDAALKVDVKSPKTKKTMFGKMYFPDVEFDIKSP
KFKAEAPLPSPKLEGELQAPDLELSLPAIHVEGLDIKAKAPKVKMPDVDISVPKIEGDLK
GPKVQANLGAPDINIEGLDAKVKTPSFGISAPQVSIPDVNVNLKGPKIKGDVPSVGLEGP
DVDLQGPEAKIKFPKFSMPKIGIPGVKMEGGGAEVHAQLPSLEGDLRGPDVKLEGPDVSL
KGPGVDLPSVNLSMPKVSGPDLDLNLKGPSLKGDLDASVPSMKVHAPGLNLSGVGGKMQV
GGDGVKVPGIDATTKLNVGAPDVTLRGPSLQGDLAVSGDIKCPKVSVGAPDLSLEASEGS
IKLPKMKLPQFGISTPGSDLHVNAKGPQVSGELKGPGVDVNLKGPRISAPNVDFNLEGPK
VKGSLGATGEIKGPTVGGGLPGIGVQGLEGNLQMPGIKSSGCDVNLPGVNVKLPTGQISG
PEIKGGLKGSEVGFHGAAPDISVKGPAFNMASPESDFGINLKGPKIKGGADVSGGVSAPD
ISLGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGLHFSGPKVEGGVKGGQIGLQAPGL
SVSGPQGHLESGSGKVTFPKMKIPKFTFSGRELVGREMGVDVHFPKAEASIQAGAGDGEW
EESEVKLKKSKIKMPKFNFSKPKGKGGVTGSPEASISGSKGDLKSSKASLGSLEGEAEAE
ASSPKGKFSLFKSKKPRHRSNSFSDEREFSGPSTPTGTLEFEGGEVSLEGGKVKGKHGKL
KFGTFGGLGSKSKGHYEVTGSDDETGKLQGSGVSLASKKSRLSSSSSNDSGNKVGIQLPE
VELSVSTKKE
NT seq 17673 nt   +upstreamnt  +downstreamnt
atggagaaggaggagacaacccgggagctgctgctgcccaactggcagggtagtggctcc
cacgggctgaccatcgcccagagggacgacggcgtctttgtgcaggaggtgacgcagaac
tcccctgcggcccgcactggggtggtcaaggagggggaccagattgtgggtgccaccatc
tactttgacaacctgcagtcgggtgaggtgacccagctgctgaacaccatggggcaccac
acggtgggcctgaagctgcaccgcaagggggaccgctctcccgagcctggccagacctgg
acccgtgaagtcttcagctcctgcagctctgaagtggttctgagcggggatgatgaggag
taccagcgcatctacaccacgaagatcaagccacggctgaagtcggaagatggagtggaa
ggagacctcggggagacccagagccgtaccatcacagtgaccagaagggtcacggcctac
actgtggatgtgactggccgggaaggagccaaggacatagacatcagtagccctgaattc
aagatcaagattccaagacatgaactgactgaaatctccaatgtggatgtggagacccag
tctgggaagaccgtgatcagactgccctcgggctcgggggcagcctctccgacaggctct
gctgtggatatccgagcaggggccatttctgcttcaggaccagagctccaaggtgctggc
cactcgaagctccaggtcaccatgcctgggataaaggtgggaggctcaggtgtcaatgtc
aatgcaaagggcttggacttgggtggcagaggaggggtccaagttccagcagtggacatt
tcatcttctcttgggggtagggcagtagaggtacagggcccatctctggagagtggtgat
catggcaaaattaaatttcccaccatgaaagtgccgaaatttggtgtctcaacagggcgt
gagggccagacaccaaaggcagggctgagggtttctgcacctgaagtctctgtggggcac
aagggcggcaagccaggcttgactatccaagcccctcagctggaagtcagtgtgccctct
gccaatattgagggccttgaggggaagctgaagggcccccaaatcactgggccatcactt
gagggtgacctaggcctgaaaggtgccaagccacaggggcacattggggtggatgcctct
gctccccaaattgggggtagcatcactggccccagtgtggaagttcaggcccctgacatt
gatgttcaggggcctgggagcaaactgaatgtgcccaagatgaaagtccccaagttctct
gtatcaggtgcaaagggagaggaaactgggattgatgtgacactgcctacaggtgaagtg
actgttcctggggtctctggggatgtcagcctgcctgagattgctactggtgggctggaa
ggaaagatgaaaggtactaaagtgaagactcctgaaatgattattcagaaacctaaaatc
tccatgcaggatgtggatctgagccttgggtctcctaaactgaaaggagatattaaggtt
tctgctcctggggtgcaaggtgatgttaaaggccctcaagtggcacttaaaggctccaga
gtggacatagagacaccaaacctagagggaaccttgacaggccctaggcttggcagtcct
tccgggaaaaccggaacctgtaggatctctatgtcagaagtagacttaaatgtggccgca
cctaaagtgaaagggggtgtagatgtcacactccccagagtagaagggaaagtcaaagtc
cctgaagttgatgtcagaggccccaaagtggatgtcagtgccccagatgtcgaagcgcat
ggcccagaatggaacctgaaaatgcccaagatgaaaatgcccacgttcagcactccagga
gccaaaggggaaggtccagatgttcatatgactctacccaaaggagatatcagtatttca
gggcccaaggtcaatgtggaagccccagatgtcaacttggagggtctggggggaaaactt
aaaggccccgatgttaagctgcctgatatgagtgtcaagacaccaaagatctccatgcct
gatgtagatttgcacgtgaaaggtacaaaggtgaagggagagtatgatgtaactgtacca
aagctggaaggagaactcaaaggcccaaaagtggacattgatgccccagatgtggatgtt
catggcccagactggcacttgaagatgcccaagatgaaaatgcccaaattcagtgtgcca
gggttcaaagcagagggcccagaagtggatgtgaacctgcccaaggctgatgtggacatt
tccgggcccaagatagatgttactgctcctgatgtgagcattgaggaaccagaagggaaa
ttgaaagggcccaagtttaagatgcctgagatgaacatcaaagtccccaagatctccatg
cctgatgtggacttacatctgaaaggccctaacgtaaagggagaatatgatgtcacaatg
ccaaaggttgaaagtgagattaaagttcctgatgttgaacttaaaagtgccaaaatggac
attgatgtcccagatgtggaggttcaaggcccagactggcacctgaagatgcccaagatg
aaaatgcccaagttcagcatgcctggcttcaaagcagagggcccagaagtggatgtgaac
ctgcccaaggctgatgtggacatctcaggacccaaggtgggtgttgaagttccagatgtg
aatattgaaggacctgaaggaaagctgaagggccccaagttcaagatgccagagatgaat
atcaaggcccccaagatctccatgcctgatgtggacttgcatatgaaaggtcctaaagta
aagggagaatatgatatgacagtgccaaagctggaaggggacctgaaaggcccaaaagta
gatgtcagtgccccagatgttgaaatgcagggtcctgactggaacttgaagatgccaaag
attaaaatgcccaaatttagcatgcccagcctcaaaggagaggggccagaatttgatgtg
aacctgtccaaagcgaatgtggacatttctgcaccaaaagtagatactaatgctccagat
ctgagccttgaaggacctgaagggaagttgaaaggcccgaagtttaagatgcctgagatg
cacttcagagctcctaagatgtctttgccagatgttgacctggatcttaaaggacccaaa
atgaaaggaaatgtagatatctctgcaccaaagatagagggtgaaatgcaggttccagat
gtggacatcagaggtcccaaggtagatattaaagcaccagatgtggaaggccaaggcctg
gactggagcctgaaaatacccaagatgaaaatgcccaagttcagcatgcccagcctcaaa
ggcgagggcccagaagtggatgtgaacttgcctaaggctgacgttgttgtctcaggaccc
aaggtggacatcgaagccccagatgtgagcctcgaaggtccagaagggaagctgaagggt
cccaagtttaagatgcctgagatgcatttcaagacccccaagatctccatgcctgatgtg
gacttacacttgaaaggccccaaagtcaaaggggatgtggatgtgtctgtgcccaaggta
gaaggtgaaatgaaagtgccagatgttgaaatcaaaggacccaaaatggacattgatgcc
ccagatgtggaggttcaaggcccagactggcacctgaagatgcccaagatgaaaatgccc
aagtttagcatgcctggcttcaaaggagagggccgagaagtggatgtgaacctgcccaag
gctgacattgatgtctcaggacccaaggtggatgttgaagtcccagatgtgagccttgag
ggcccggaaggaaagctgaagggccccaagtttaagatgcctgagatgcacttcaaggcc
cccaagatctccatgcctgatgtggacctgaatcttaaggggccaaaattgaagggagat
gtggatgtgtccttgcctgaggtagaaggtgaaatgaaagtgccagatgttgacattaaa
gggcccaaagttgacattagtgctccagatgtggatgttcatggcccagattggcacctg
aagatgcccaaggtgaaaatgcccaagttcagcatgcccggcttcaaaggagagggccct
gaagtggatgtgaagctgcccaaagctgacgttgatgtctcaggacccaaaatggatgct
gaagttccagatgtgaatattgaaggtccagacgcaaaactaaaaggtcccaaattcaag
atgccagaaatgagtataaagcctcagaagatatccataccagatgttggtttgcatttg
aaaggtcctaaaatgaaaggagattatgatgtaacagttccaaaagtagaaggagagata
aaagctcctgatgttgacatcaaaggccccaaagttgatattaatgcaccagatgtggag
gttcatggcccagactggcacctgaagatgcccaaggtaaaaatgcccaagttcagcatg
cctggctttaaaggagagggcccagaggtggatatgaacctgcccaaggctgaccttggt
gtttcaggacccaaggtggacattgatgttccagatgtgaatcttgaagctccagagggg
aaactaaaaggccctaagttcaagatgccaagcatgaatatacagacgcacaaaatctct
atgcctgatgttggacttaatttgaaagcccctaaactgaaaactgatgtagatgtttcc
cttcccaaagtggaaggagacttgaagggtcctgaaattgatgtgaaagcccctaagatg
gatgtgaatgttggtgatattgatattgaaggtccagaagggaagttgaagggccccaag
tttaagatgcctgagatgcatttcaaggcccccaagatctccatgcccgatgtggactta
cacttgaaaggccccaaagtcaaaggggatatggatgtgtctgtgcccaaggtagaaggt
gaaatgaaagtgccagatgttgacattaaagggcccaaagtggacattgatgccccagat
gtggaggttcacgacccagattggcacctgaaaatgcccaagatgaaaatgcccaagttc
agtatgcctggcttcaaagcagagggccctgaagtggatgtgaatctgccaaaggctgac
attgatgtgtctggacccagtgtggacactgatgctcctgatttggatattgagggacca
gaaggaaagttgaaaggctccaaatttaagatgcccaagttgaatataaaagctcccaag
gtctccatgccagatgtggacttgaatttgaagggacccaaactgaagggagagatagat
gcttctgtgccagaactggaaggtgatctcagagggccgcaagttgatgtcaaaggtcct
tttgtggaagcggaggtgcccgatgttgatctggagtgtcctgatgcaaagttgaaaggg
cccaagtttaagatgcctgagatgcacttcaaggcccccaagatctccatgcctgatgtg
gacttacacctgaaaggccccaaagtcaaaggggatgcggatgtgtcggtgccaaaattg
gagggagatttaacaggccccagtgtgggtgtggaggtgcctgatgttgagctggagtgt
cctgatgcaaagttgaaaggccctaaatttaagatgccagacatgcacttcaaggccccc
aagatctccatgcctgatgtggacttacacttgaaaggccccaaagtcaaaggggatgtg
gatgtgtcggtgccaaaattggagggagatttaacaggtcccagtgtgggtgtggaggtg
cctgatgttgagctggagtgtcctgatgcaaagttgaaagggcccaagtttaagatgcct
gagatgcacttcaagacccccaagatctccatgcctgatgtggacttacacctgaaaggc
cccaaagtcaaaggggatatggatgtgtctgtgcccaaggtagaaggtgaaatgaaagtg
ccagatgttgacatcaaaggacccaaaatggacattgatgccccagatgtggatgttcat
ggcccagactggcacctgaagatgcccaagatgaaaatgcccaagttcagcatgcctggc
ttcaaagcagagggcccagaagtggatgtgaacttgcccaaggctgatgttgttgtctca
ggacccaaggtggatgttgaagtcccagatgtgagccttgaaggtccagaagggaagctg
aagggccccaagcttaagatgcctgagatgcacttcaaggcccccaagatctccatgcct
gatgtggacttacacttgaaaggccccaaagtcaaaggggatgtggatgtgtctttgcca
aaattggagggagatttaacaggccccagtgtggatgtggaggtgcctgatgttgagctg
gagtgtcctgatgcaaagttgaaagggcccaagtttaagatgcctgagatgcacttcaag
acccccaagatctccatgcctgatgtgaacttaaacttgaaaggccccaaagtcaaaggg
gatatggatgtgtctgttcccaaggtagaaggtgaaatgaaagtgccagatgttgacatc
agagggcccaaagtggacattgatgccccagatgtggatgttcatggcccagactggcac
ctgaagatgcctaagatgaaaatgcccaagttcagcatgcctggcttcaaaggagagggc
ccagaagtggatgtgaacttgcccaaggctgacgttgatgtctcaggacccaaggtggat
gttgaagtcccagatgtgagccttgaaggtccagaagggaagctgaagggccccaagttt
aagatgcctgagatgcacttcaagacccccaagatctccatgcctgatgttgatttcaat
ttaaagggacccaaaatcaaaggagatgttgatgtttctgccccaaagctggagggagag
ttaaaaggtccagaattggatgtcaaaggtcccaaattagatgctgacatgccagaagta
gctgtggaaggcccaaatggcaagtggaaaactcctaagttcaagatgccagatatgcac
tttaaagctcccaaaatctctatgccagacctcgatctacacttgaagagccccaaggca
aaaggagaggtggatgtagatgttcccaaattggaaggggaccttaaagggccacatgtg
gatgtcagtgggccagacattgacattgagggaccagagggcaaattgaaaggccctaag
ttcaagatgcctgatatgcatttcaaagcccccaatatttctatgcctgatgttgatcta
aatctcaaaggacccaaaatcaagggggatgtggatgtgtctgtgcctgaggtagaaggt
aaacttgaagtaccagatatgaacatcaggggccccaaagttgatgtaaatgcccccgat
gtccaagctccagactggcacctgaagatgcccaagatgaaaatgcccaagttcagcatg
cctggcttcaaagcagagggccctgaagtagacgtcaacttgcctaaggctgacgttgac
atctcaggacccaaggtggacattgaaggccctgatgttaatattgaaggaccagaggga
aagttgaaagggcctaagttaaagatgccagagatgaacatcaaagcccccaagatctcc
atgcctgactttgatttgcatctgaaaggtcccaaggtgaagggcgatgtggatgtttct
ctgcccaaagtggaaggtgacctcaagggccccgaagttgacatcaaggggcccaaagtg
gatattaatgccccagatgtgggtgttcaaggcccagactggcacctgaagatgcccaag
gtgaaaatgccaaagttcagcatgcctggcttcaaaggagagggcccagatggggatgtg
aagctgcccaaggctgacattgatgtctcaggacccaaagtggacattgaaggccctgat
gttaacattgaaggaccagagggaaagttgaaagggcctaagttcaagatgccagagatg
aatatcaaagcccccaagatctccatgcctgatattgacttaaacctgaaaggacccaaa
gtgaagggtgatgtggatgtttcccttcctaaagtggaaggtgacctcaagggcccagaa
gttgacatcaagggcccaaaagtggacattgacgcacctgatgttgatgttcatggccca
gactggcacctaaagatgcccaagataaaaatgcccaagatcagcatgcctggcttcaaa
ggagaaggtccagatgtggacgtgaacctgcccaaggctgacattgatgtctcaggaccg
aaagtggatgttgaatgtcccgatgtgaatatcgaaggacctgaaggaaagtggaaaagt
ccaaagtttaagatgccagagatgcattttaagactccaaagatatccatgccagatatt
gacctgaatctcacaggtccaaaaataaaaggagatgtggatgttacaggccctaaggta
gagggagatctgaaaggtcctgaagttgacctcaaaggccccaaagtggacattgatgtc
ccagatgttaatgttcagggtccagactggcacctgaagatgcccaagatgaaaatgccc
aagttcagcatgcctggcttcaaagcagagggccctgaagtggatgtgaacctgcccaag
gctgacgttgatgtctcaggccccaaagtggacgttgaaggccctgatgttaacattgaa
ggaccagagggaaagttgaaagggcccaagttcaagatgccagagatgaatatcaaagcc
cccaagatccccatgcctgactttgatttgcatctgaaaggtcccaaggtgaagggcgat
gtggatatttctctgcccaaagtggaaggtgacctcaagggccctgaagttgacatcagg
ggtccccaagtggacattgatgtcccggatgtgggcgttcaaggcccagactggcaccta
aaaatgcccaaagtgaaaatgcccaaattcagcatgcctggcttcaaaggagagggccca
gatgtggatgtgaacctgcccaaggctgaccttgatgtctcaggacccaaggtggacatt
gatgttccagatgtgaatatcgaaggcccagagggaaagttgaaaggtcccaaattcaaa
atgcctgagatgaacatcaaagcccccaagatctccatgcctgacattgatcttaacctg
aaaggtcccaaagtgaagggtgacatggatgtgtctctgccaaaagtggaaggtgacatg
aaagttcctgacgtggatattaaaggccccaaagtggatattaatgccccagatgtggat
gttcaaggcccagactggcacctgaagatgcctaaaataaaaatgcccaagatcagcatg
cctggcttcaaaggagaaggtccagaagtggacgtgaacctgcccaaggctgaccttgac
gtctcaggacccaaggtggacgttgatgttccagatgtgaatattgaaggtccagatgcg
aaactgaagggccctaaattcaagatgccagagatgaacatcaaagctcctaaaatatca
atgcctgatttggacctcaatcttaaaggccctaaaatgaaaggagaggtggatgtttca
cttgcaaatgtagaaggtgatttgaaaggacctgctcttgacataaaaggcccaaagata
gatgtagatgctccagatattgacattcatggcccagatgccaaattaaaaggtccaaaa
ctgaagatgcctgacatgcatgtaaacatgcccaagatctccatgccagaaattgacttg
aatttgaaaggctcaaagcttaagggagatgttgatgtctctgggcccaagttggaaggt
gacattaaagctcccagtttggatataaagggcccagaagtggacgtttccggtcctaag
cttaatatcgaaggcaagtcaaagaaatctcgttttaagcttcccaaatttaatttttcg
ggctctaaagttcagacacctgaagtggatgtcaaaggtaaaaagccagatattgacata
acaggtccaaaagttgatattaatgctcctgatgtcgaggtccaaggaaaagtgaaagga
tccaagtttaaaatgcctttcctgagtatttcatctcccaaagtttctatgcctgacgtg
gagctaaatttgaaaagtcccaaagtcaaaggagacttagatattgcaggtcccaattta
gaaggtgactttaaaggccccaaagtggatattaaggcaccagaagtcaatcttaatgca
cctgatgtggatgttcatggtccagactggaatctgaaaatgcccaagatgaaaatgccc
aaattcagtgtgtctggcttaaaagcagaagggccagatgtagctgtggatctaccaaaa
ggagacatcaacatagagggcccaagtatgaacattgagggcccagatctcaatgtggaa
ggtccggagggaggcttgaaaggtcccaaattcaagatgcctgacatgaatatcaaagct
cccaagatctccatgcctgacattgacttaaacttgaaaggccccaaggtgaaaggtgat
gtggatatttctcttcccaaacttgaaggggatctgaaagggccagaggttgatatcaaa
ggccctaaagtggacatcaatgccccagatgtggatgttcatggtccagactggcatctg
aagatgcccaaagtgaaaatgcccaagttcagcatgcctggcttcaaaggagaaggccct
gaagtcgatgttaccctccctaaagctgacattgacatttctggtcccaatgtagacgtt
gatgttccagacgtgaatattgaaggtccagatgcaaagctgaagggccccaagttcaag
atgcctgagatgaacatcaaagcccccaagatctccatgcctgactttgacctgaacttg
aagggacccaaaatgaagggtgatgtggttgtgtctttgcccaaagtggaaggtgatcta
aaaggccctgaggtggacatcaagggccccaaagtggacattgacactcctgacattaac
atcgaaggctcagagggtaaattcaagggacccaaatttaagataccagagatgcacctg
aaggctcccaaaatatcgatgcctgacattgatttaaacctgaagggccccaaagtcaag
ggcgatgtggatgtttctctgcccaaaatggaaggtgacctcaagggtcctgaagttgac
atcaagggccccaaagtggacattaatgctccagatgttgatgttcaaggcccagactgg
cacctgaagatgcccaaggtgaaaatgcccaagttcagcatgcctggcttcaaaggagag
ggcccagatgtggatgtgaacctgcccaaggctgaccttgatgtctcaggacccaaggtg
gacattgatgttccagatgtgaatatcgaaggcccagagggaaagttgaaaggtcccaaa
ttcaagatgcctgagatgaacatcaaagcccccaagatctccatgcctgacattgatctt
aacctgaaaggacccaaagtgaagggtgatatggatgtgtctctgccaaaagtggaaggt
gacatgcaagttcctgacttggatattaaaggccccaaagtggatattaatgccccagat
gtggatgttcgaggcccagactggcacctgaagatgcctaagataaaaatgcccaagatc
agcatgcctggcttcaaaggagaaggtccagaagtggatgtgaacctgcccaaggctgac
cttgacgtctcaggacccaaggtggacgttgatgttccagatgtgaatattgaaggtcca
gatgcgaaactgaagggccctaaattcaagatgccagagatgaacatcaaagcccccaag
atctccatgcctgactttgatttgcatctgaaaggccctaaggtgaaaggagatgtggat
gtttctctgcctaagatggaaggtgatctaaaggcccctgaagttgacatcaagggcccc
aaagtggacattgatgccccagatgtggatgttcatggcccagactggcacctgaagatg
cccaaggtgaaaatgcccaaattcagcatgccaggatttaaaggagagggcccagaagtg
gatgttaatttgcccaaagctgacattgatgtctcaggacccaaagtggacattgacact
cctgatattgatattcatggtccagaagggaaactgaagggccccaaatttaaaatgcct
gacctgcacctcaaggcaccgaagatctctatgcctgaagttgacctgaatctgaaaggt
ccaaagatgaagggcgacgtggacgtttctctgcccaaagtggaaggcgacctcaagggc
cctgaagttgacatcaagggccccaaagtggacattgatgtcccagatgtggacgttcaa
ggcccagactggcacttaaaaatgcccaaagtgaaaatgcccaagttcagcatgcctggc
ttcaaaggagagggcccagatgtggatgtgaacctgcccaaggctgaccttgacgtctca
ggacccaaggtggacattgatgttcctgatgtgaatatcgaaggtccagatgcgaaacta
aagggccctaaattcaagatgcctgagatgaacatcaaagcccccaagatctccatgcct
gactttgatttgcatctgaaaggtcccaaggtgaagggtgatgtggatgtttcccttcct
aaagtggaaggtgacctcaagggcccagaagttgacatcaagggccccaaagtggacatc
gatgcccctgatgtagatgttcatggcccagactggcacctgaagatgcccaaggtgaaa
atgcccaaattcagcatgccaggattcaaaggagagggcccagatgtggatgttaccctt
cctaaggctgacattgagatttctggccccaaagtggacattgatgcccctgatgtcagt
atcgaaggtccagatgcaaaactcaagggtccaaagttcaagatgccagagatgaacatc
aaggcccccaaaatctccatgcctgacattgactttaacttgaagggtcccaaagtgaaa
ggtgatgtggatgtctctctgcccaaagtggaaggtgatctcaagggccctgaaattgac
ataaaaggccccagtttggacattgacacacctgatgtcaatattgaaggtccggaagga
aaattgaaggggcccaaatttaagatgcctgagatgaacatcaaagctcccaaaatctct
atgcctgactttgatttgcacctgaaaggtcccaaggtgaagggtgatgtggatgtttca
ctacctaaggtggaaagtgatctgaaagggccagaggtagacattgaaggtcctgaaggg
aagctcaaaggtcccaagtttaagatgcctgatgtacatttcaaaagcccacaaatctcc
atgagtgacattgatttgaatttgaaaggacctaagataaaaggagatatggacatttcc
gttcctaaactggagggagatctgaaaggtcccaaagtggatgtcaaaggccctaaagtg
ggcattgacactcctgatattgacattcatggtccagaagggaaactgaagggccccaaa
tttaaaatgcctgacttacacctcaaggcaccgaagatctctatgcctgaagttgacctg
aatctgaaaggtccaaaggtgaagggcgacatggacatttctctgcccaaagtggaaggc
gacctcaagggccccgaagttgacatcagggaccccaaagtggacattgatgtcccagat
gtggacgttcaaggcccagactggcacctaaaaatgcccaaagtgaaaatgcccaagttc
agcatgcctggcttcaaaggagagggcccagatgtggatgtgaacctgcccaaggctgac
attgatgtctcaggacccaaagtggacgttgatgttcctgatgtgaatatcgaaggtcca
gatgcgaaactaaagggccccaagttcaagatgcctgagatgagcatcaaagcccccaag
atctccatgcctgatattgacttaaacctgaaaggacccaaagtgaagggcgatgtggat
gttacccttcctaaagtggaaggtgacctcaagggcccagaagctgacatcaagggccca
aaagtggacatcaacacccctgatgtggatgttcatggcccagactggcacctgaagatg
cccaaggtgaaaatgcccaaattcagcatgcctggcttcaaaggagaaggtccagatgtg
gatgtgagcctgcccaaggccgacatcgatgtctcgggacccaaggtggacgttgatatt
ccagatgtgaatatcgaaggtccagacgcaaaactgaagggccccaagttcaagatgcct
gaaataaatatcaaagctcccaagatctccatacctgatgttgacctggatttgaaagga
cccaaagtaaaaggagattttgatgtgtctgtccctaaggttgaagggactttgaaaggc
ccagaagtagatcttaaaggtccacgtctggatttcgaaggccctgatgccaaactcagt
ggcccatctttgaagatgccatcgctggagatatctgctcctaaagtaactgctcctgat
gttgatttgcatctcaaggcaccaaaaattggattttcaggtccgaagttagaaggtggt
gaagtggacctcaagggacccaaagttgaagctccaagcttagatgtacacatggacagc
ccagatattaacatcgaagggccagatgttaaaatccccaaatttaagaaacccaagttt
ggatttggggcaaaaagccccaaagctgacatcaagtcaccttcactggatgtcactgtt
cctgaggcagagctgaaccttgagactcctgaaattagtgttggtggcaagggcaagaaa
agtaagtttaaaatgcctaaaattcatatgagtggtcctaagattaaggccaaaaaacag
ggatttgacctgaatgttcctgggggtgaaattgatgccagcctcaaggctccggatgta
gatgtcaacatcgcagggccggatgctgcactcaaagtcgacgtgaaatcgcccaaaacc
aagaaaacgatgtttggaaaaatgtacttcccagatgtagagtttgacattaaatcacct
aaatttaaagctgaggcccctctccctagccccaaactggagggtgaactccaggcacct
gatctggaactttctttgccagcgattcacgtcgaaggtcttgacatcaaggcgaaggct
cccaaggtcaagatgccagatgtggacatctcagtgccaaaaatagagggtgacctgaaa
ggccccaaagtgcaggcaaacttgggtgcacctgacatcaacatcgaaggcctagatgct
aaagtcaaaacaccgtccttcggcatttctgcccctcaagtctccatccctgatgtgaat
gtaaacttgaaaggaccaaagataaagggtgatgtccccagcgtgggactggaaggacca
gatgtagatctgcaaggtccagaagcaaaaattaagttccccaagttttccatgcccaag
atcggcatcccaggtgtgaaaatggagggtgggggagccgaggtccatgcccagctaccc
tctcttgaaggagacttgagaggaccagatgttaagctcgaagggcccgatgtttctcta
aaggggccaggagtagacttgccttcagtgaacctctctatgccaaaagtctctgggcct
gaccttgatctgaacttgaaaggaccaagtttgaagggagacctggatgcatctgttccc
agcatgaaggtgcatgctccagggctcaacctcagtggtgtcggtggcaaaatgcaggtg
ggaggagacggtgtgaaagtgccagggatcgatgccacaacaaagcttaacgttggggca
ccagatgtgacactgaggggaccaagcctgcagggagatctggctgtctctggtgacatc
aaatgccctaaagtatccgtaggagctcctgatctaagcttggaggcatccgaaggcagc
attaaacttcccaaaatgaagctgccccaatttggcatctctactccggggtccgacttg
cacgtcaatgccaaggggccacaggtttctggcgaactgaaggggccaggtgtggatgtg
aacctgaaagggcctcggatttcagcaccgaatgtggactttaacttggaaggaccaaaa
gtgaaagggagccttggggccactggtgagatcaaaggccccactgtcggaggaggtctt
ccaggcattggtgttcaaggcctagaaggaaacctccagatgcctggaattaagtcctct
ggatgtgatgtgaacctgccaggcgtgaatgtgaaactcccaactgggcagatttctggg
cctgaaatcaaaggtggtctgaaaggttcagaagtaggtttccatggggctgctcctgat
atcagtgtgaaggggcctgcctttaatatggcatctcctgagtcagattttggcatcaac
ttgaagggcccaaaaatcaaaggaggtgcggatgtttcagggggtgtcagtgccccagac
atcagccttggtgaagggcatttgagtgttaaaggttccgggggtgagtggaagggaccc
caagtctcctctgctctcaacttggacacatctaagtttgctgggggccttcatttctca
ggaccaaaggtggaaggaggtgtgaaaggaggtcagattggactccaggctcctgggctg
agtgtgtctgggcctcaaggtcacttggaaagtggatctggaaaagtaacattccctaaa
atgaagatccccaaatttaccttctctggccgtgagctggttggcagagaaatgggggtg
gatgttcacttccctaaagcagaggccagcatccaagctggtgctggagacggcgagtgg
gaagagtctgaagtcaaactgaaaaagtccaagatcaaaatgcccaagtttaatttttcc
aaacctaaagggaaaggtggtgtcactggctcaccagaagcatcaatttctgggtccaaa
ggtgacctgaaaagttcaaaggccagcctgggctctctggaaggagaggcagaggccgaa
gcctcttcaccgaaaggcaaattctccttatttaaaagtaagaagccacggcaccgctca
aattcattcagtgatgaaagagagttctctggaccttccaccccgacggggacgctggag
tttgaaggtggggaagtgtctctggaaggtgggaaagttaaagggaaacacgggaagctg
aaattcggtacctttggtggattggggtcaaagagcaaaggtcattatgaggtgactggg
agcgatgatgagacaggcaagttacaggggagtggggtgtccctggcctctaagaagtcc
cgactgtcctcctcttctagcaatgacagtgggaataaggttggcatccagcttcccgag
gtggagctgtcagtttccacaaagaaagagtag

DBGET integrated database retrieval system