KEGG   Homo sapiens (human): 79054
Entry
79054             CDS       T01001                                 
Symbol
TRPM8, LTRPC6, LTrpC-6, TRPP8, trp-p8
Name
(RefSeq) transient receptor potential cation channel subfamily M member 8
  KO
K04983  transient receptor potential cation channel subfamily M member 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Menthol (DG01385): D00064<JP> D04849 D04918
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    79054 (TRPM8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    79054 (TRPM8)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   79054 (TRPM8)
SSDB
Motif
Pfam: LSDAT_euk LSDAT_prok Ion_trans
Other DBs
NCBI-GeneID: 79054
NCBI-ProteinID: NP_076985
OMIM: 606678
HGNC: 17961
Ensembl: ENSG00000144481
Pharos: Q7Z2W7(Tclin)
UniProt: Q7Z2W7 W8DTH1
LinkDB
Position
2:233917373..234019522
AA seq 1104 aa
MSFRAARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFKKRECVFFTKD
SKATENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRL
SCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIL
TGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEGYFLAQY
LMDDFTRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
IVCFAQGGGKETLKAINTSIKNKIPCVVVEGSGQIADVIASLVEVEDALTSSAVKEKLVR
FLPRTVSRLPEEETESWIKWLKEILECSHLLTVIKMEEAGDEIVSNAISYALYKAFSTSE
QDKDNWNGQLKLLLEWNQLDLANDEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLEN
GLNLRKFLTHDVLTELFSNHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRGFRKEDR
NGRDEMDIELHDVSPITRHPLQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKT
LAKVKNDINAAGESEELANEYETRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELA
VEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGFVSFRKKPVDKH
KKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFAYVLLMDFHSVPHPPELVLYSLVFVLFC
DEVRQWYVNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFT
LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIF
RSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV
CIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCSRLNIPFPFIVFAY
FYMVVKKCFKCCCKEKNMESSVCCFKNEDNETLAWEGVMKENYLVKINTKANDTSEEMRH
RFRQLDTKLNDLKGLLKEIANKIK
NT seq 3315 nt   +upstreamnt  +downstreamnt
atgtcctttcgggcagccaggctcagcatgaggaacagaaggaatgacactctggacagc
acccggaccctgtactccagcgcgtctcggagcacagacttgtcttacagtgaaagcgac
ttggtgaattttattcaagcaaattttaagaaacgagaatgtgtcttctttaccaaagat
tccaaggccacggagaatgtgtgcaagtgtggctatgcccagagccagcacatggaaggc
acccagatcaaccaaagtgagaaatggaactacaagaaacacaccaaggaatttcctacc
gacgcctttggggatattcagtttgagacactggggaagaaagggaagtatatacgtctg
tcctgcgacacggacgcggaaatcctttacgagctgctgacccagcactggcacctgaaa
acacccaacctggtcatttctgtgaccgggggcgccaagaacttcgccctgaagccgcgc
atgcgcaagatcttcagccggctcatctacatcgcgcagtccaaaggtgcttggattctc
acgggaggcacccattatggcctgatgaagtacatcggggaggtggtgagagataacacc
atcagcaggagttcagaggagaatattgtggccattggcatagcagcttggggcatggtc
tccaaccgggacaccctcatcaggaattgcgatgctgagggctattttttagcccagtac
cttatggatgacttcacaagagatccactgtatatcctggacaacaaccacacacatttg
ctgctcgtggacaatggctgtcatggacatcccactgtcgaagcaaagctccggaatcag
ctagagaagtatatctctgagcgcactattcaagattccaactatggtggcaagatcccc
attgtgtgttttgcccaaggaggtggaaaagagactttgaaagccatcaatacctccatc
aaaaataaaattccttgtgtggtggtggaaggctcgggccagatcgctgatgtgatcgct
agcctggtggaggtggaggatgccctgacatcttctgccgtcaaggagaagctggtgcgc
tttttaccccgcacggtgtcccggctgcctgaggaggagactgagagttggatcaaatgg
ctcaaagaaattctcgaatgttctcacctattaacagttattaaaatggaagaagctggg
gatgaaattgtgagcaatgccatctcctacgctctatacaaagccttcagcaccagtgag
caagacaaggataactggaatgggcagctgaagcttctgctggagtggaaccagctggac
ttagccaatgatgagattttcaccaatgaccgccgatgggagtctgctgaccttcaagaa
gtcatgtttacggctctcataaaggacagacccaagtttgtccgcctctttctggagaat
ggcttgaacctacggaagtttctcacccatgatgtcctcactgaactcttctccaaccac
ttcagcacgcttgtgtaccggaatctgcagatcgccaagaattcctataatgatgccctc
ctcacgtttgtctggaaactggttgcgaacttccgaagaggcttccggaaggaagacaga
aatggccgggacgagatggacatagaactccacgacgtgtctcctattactcggcacccc
ctgcaagctctcttcatctgggccattcttcagaataagaaggaactctccaaagtcatt
tgggagcagaccaggggctgcactctggcagccctgggagccagcaagcttctgaagact
ctggccaaagtgaagaacgacatcaatgctgctggggagtccgaggagctggctaatgag
tacgagacccgggctgttgagctgttcactgagtgttacagcagcgatgaagacttggca
gaacagctgctggtctattcctgtgaagcttggggtggaagcaactgtctggagctggcg
gtggaggccacagaccagcatttcatcgcccagcctggggtccagaattttctttctaag
caatggtatggagagatttcccgagacaccaagaactggaagattatcctgtgtctgttt
attatacccttggtgggctgtggctttgtatcatttaggaagaaacctgtcgacaagcac
aagaagctgctttggtactatgtggcgttcttcacctcccccttcgtggtcttctcctgg
aatgtggtcttctacatcgccttcctcctgctgtttgcctacgtgctgctcatggatttc
cattcggtgccacacccccccgagctggtcctgtactcgctggtctttgtcctcttctgt
gatgaagtgagacagtggtacgtaaatggggtgaattattttactgacctgtggaatgtg
atggacacgctggggcttttttacttcatagcaggaattgtatttcggctccactcttct
aataaaagctctttgtattctggacgagtcattttctgtctggactacattattttcact
ctaagattgatccacatttttactgtaagcagaaacttaggacccaagattataatgctg
cagaggatgctgatcgatgtgttcttcttcctgttcctctttgcggtgtggatggtggcc
tttggcgtggccaggcaagggatccttaggcagaatgagcagcgctggaggtggatattc
cgttcggtcatctacgagccctacctggccatgttcggccaggtgcccagtgacgtggat
ggtaccacgtatgactttgcccactgcaccttcactgggaatgagtccaagccactgtgt
gtggagctggatgagcacaacctgccccggttccccgagtggatcaccatccccctggtg
tgcatctacatgttatccaccaacatcctgctggtcaacctgctggtcgccatgtttggc
tacacggtgggcaccgtccaggagaacaatgaccaggtctggaagttccagaggtacttc
ctggtgcaggagtactgcagccgcctcaatatccccttccccttcatcgtcttcgcttac
ttctacatggtggtgaagaagtgcttcaagtgttgctgcaaggagaaaaacatggagtct
tctgtctgctgtttcaaaaatgaagacaatgagactctggcatgggagggtgtcatgaag
gaaaactaccttgtcaagatcaacacaaaagccaacgacacctcagaggaaatgaggcat
cgatttagacaactggatacaaagcttaatgatctcaagggtcttctgaaagagattgct
aataaaatcaaataa

DBGET integrated database retrieval system