KEGG   Homo sapiens (human): 79184
Entry
79184             CDS       T01001                                 

Gene name
BRCC3, BRCC36, C6.1A, CXorf53
Definition
(RefSeq) BRCA1/BRCA2-containing complex subunit 3
  KO
K11864  BRCA1/BRCA2-containing complex subunit 3 [EC:3.4.19.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    79184 (BRCC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    79184 (BRCC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    79184 (BRCC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    79184 (BRCC3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    79184 (BRCC3)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    79184 (BRCC3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.-  
     79184 (BRCC3)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M67
   79184 (BRCC3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    79184 (BRCC3)
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    79184 (BRCC3)
   BRISC complex
    79184 (BRCC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    BRISC complex
     79184 (BRCC3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     79184 (BRCC3)
SSDB
Motif
Pfam: JAB BRCC36_C Prok-JAB UPF0172 APG6_N
Other DBs
NCBI-GeneID: 79184
NCBI-ProteinID: NP_077308
OMIM: 300617
HGNC: 24185
Ensembl: ENSG00000185515
Vega: OTTHUMG00000022658
Pharos: P46736(Tbio)
UniProt: P46736
LinkDB
Structure
PDB: 
6R8F 6H3C

Position
Xq28
AA seq 316 aa
MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMR
TVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGW
YHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQK
SSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILC
QEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQE
LQQEKEELMQELSSLE
NT seq 951 nt   +upstreamnt  +downstreamnt
atggcggtgcaggtggtgcaggcggtgcaggcggttcatctcgagtctgacgctttcctc
gtttgtctcaaccacgctctgagcacagagaaggaggaagtaatggggctgtgcataggg
gagttgaacgatgatacaaggagtgactccaaatttgcatatactggaactgaaatgcgc
acagttgctgaaaaggttgatgccgtcagaattgttcacattcattctgtcatcatctta
cgacgttctgataagaggaaggaccgagtagaaatttctccagagcagctgtctgcagct
tcaacagaggcagagaggttggctgaactgacaggccgccccatgagagttgtgggctgg
tatcattcccatcctcatataactgtttggccttcacatgttgatgttcgcacacaagcc
atgtaccagatgatggatcaaggctttgtaggacttattttttcctgtttcatagaagat
aagaacacaaagactggccgggtactctacacttgcttccaatccatacaggcccaaaag
agttcagagtcccttcatggtccacgagacttctggagctccagccagcacatctccatt
gagggccagaaggaagaggaaaggtatgagagaatcgaaatcccaatccatattgtacct
catgtcactatcgggaaagtgtgccttgaatcagcagtagagctgcccaagatcctgtgc
caggaggagcaggatgcgtataggaggatccacagccttacacatctggactcagtaacc
aagatccataatggctcagtgtttaccaagaatctgtgcagtcagatgtcggcagtcagc
gggcctctcctacagtggttggaggacagactggagcaaaaccaacagcatttgcaggaa
ttacaacaagaaaaggaagagcttatgcaagaactttcttctctagaataa

DBGET integrated database retrieval system