KEGG   Homo sapiens (human): 79679
Entry
79679             CDS       T01001                                 
Symbol
VTCN1, B7-H4, B7H4, B7S1, B7X, B7h.5, PRO1291, VCTN1
Name
(RefSeq) V-set domain containing T cell activation inhibitor 1
  KO
K06747  immune costimulatory protein B7-H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    79679 (VTCN1)
SSDB
Motif
Pfam: Ig_3 V-set I-set Ig_2 ig
Other DBs
NCBI-GeneID: 79679
NCBI-ProteinID: NP_078902
OMIM: 608162
HGNC: 28873
Ensembl: ENSG00000134258
Pharos: Q7Z7D3(Tbio)
UniProt: Q7Z7D3
Structure
LinkDB
Position
1:complement(117143587..117210927)
AA seq 282 aa
MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEP
DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNV
QLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVV
WASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKV
TESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
NT seq 849 nt   +upstreamnt  +downstreamnt
atggcttccctggggcagatcctcttctggagcataattagcatcatcattattctggct
ggagcaattgcactcatcattggctttggtatttcagggagacactccatcacagtcact
actgtcgcctcagctgggaacattggggaggatggaatcctgagctgcacttttgaacct
gacatcaaactttctgatatcgtgatacaatggctgaaggaaggtgttttaggcttggtc
catgagttcaaagaaggcaaagatgagctgtcggagcaggatgaaatgttcagaggccgg
acagcagtgtttgctgatcaagtgatagttggcaatgcctctttgcggctgaaaaacgtg
caactcacagatgctggcacctacaaatgttatatcatcacttctaaaggcaaggggaat
gctaaccttgagtataaaactggagccttcagcatgccggaagtgaatgtggactataat
gccagctcagagaccttgcggtgtgaggctccccgatggttcccccagcccacagtggtc
tgggcatcccaagttgaccagggagccaacttctcggaagtctccaataccagctttgag
ctgaactctgagaatgtgaccatgaaggttgtgtctgtgctctacaatgttacgatcaac
aacacatactcctgtatgattgaaaatgacattgccaaagcaacaggggatatcaaagtg
acagaatcggagatcaaaaggcggagtcacctacagctgctaaactcaaaggcttctctg
tgtgtctcttctttctttgccatcagctgggcacttctgcctctcagcccttacctgatg
ctaaaataa

DBGET integrated database retrieval system