KEGG   Homo sapiens (human): 80119
Entry
80119             CDS       T01001                                 
Symbol
PIF1, C15orf20, PIF
Name
(RefSeq) PIF1 5'-to-3' DNA helicase
  KO
K15255  ATP-dependent DNA helicase PIF1 [EC:5.6.2.3]
Organism
hsa  Homo sapiens (human)
Network
nt06506  Double-strand break repair
nt06509  DNA replication
  Element
N01450  Break induced replication
N01473  DNA replication termination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    80119 (PIF1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    80119 (PIF1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     80119 (PIF1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    80119 (PIF1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    80119 (PIF1)
SSDB
Motif
Pfam: PIF1 AAA_30 AAA_19 Herpes_Helicase UvrD_C_2 AAA_16 RsgA_GTPase AAA_24 ABC_tran AAA_22 PhoH Mg_chelatase AAA_7 Parvo_NS1
Other DBs
NCBI-GeneID: 80119
NCBI-ProteinID: NP_001273425
OMIM: 610953
HGNC: 26220
Ensembl: ENSG00000140451
Pharos: Q9H611(Tbio)
UniProt: Q9H611
Structure
LinkDB
Position
15:complement(64815632..64827062)
AA seq 641 aa
MLSGIEAAAGEYEDSELRCRVAVEELSPGGQPRRRQALRTAELSLGRNERRELMLRLQAP
GPAGRPRCFPLRAARLFTRFAEAGRSTLRLPAHDTPGAGAVQLLLSDCPPDRLRRFLRTL
RLKLAAAPGPGPASARAQLLGPRPRDFVTISPVQPEERRLRAATRVPDTTLVKRPVEPQA
GAEPSTEAPRWPLPVKRLSLPSTKPQLSEEQAAVLRAVLKGQSIFFTGSAGTGKSYLLKR
ILGSLPPTGTVATASTGVAACHIGGTTLHAFAGIGSGQAPLAQCVALAQRPGVRQGWLNC
QRLVIDEISMVEADLFDKLEAVARAVRQQNKPFGGIQLIICGDFLQLPPVTKGSQPPRFC
FQSKSWKRCVPVTLELTKVWRQADQTFISLLQAVRLGRCSDEVTRQLQATASHKVGRDGI
VATRLCTHQDDVALTNERRLQELPGKVHRFEAMDSNPELASTLDAQCPVSQLLQLKLGAQ
VMLVKNLSVSRGLVNGARGVVVGFEAEGRGLPQVRFLCGVTEVIHADRWTVQATGGQLLS
RQQLPLQLAWAMSIHKSQGMTLDCVEISLGRVFASGQAYVALSRARSLQGLRVLDFDPMA
VRCDPRVLHFYATLRRGRSLSLESPDDDEAASDQENMDPIL
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgctctcgggcatagaggcggcggcaggggaatatgaggactcggagctgcggtgccgc
gtggctgtggaggagctgagcccgggcgggcagccgcgaaggcgccaggccctgcgcacc
gcggagctgagcctgggtcgcaacgagcgccgcgagttgatgctgcggctgcaagcgcca
gggcccgcggggcggccgcgctgctttcctctgcgcgccgcgcgcctcttcacgcgtttc
gccgaggccgggcgcagcaccctgcggctccccgcccacgacacccccggggccggcgca
gtgcagctgctgctctcggactgccccccagaccgcctgcgccgcttcctgcgcacattg
cgcctcaagctggctgcggccccgggtcccgggccggcctccgcccgagcgcagctgctg
ggcccgcggccccgcgacttcgtcaccatcagccctgtgcagcccgaggagcggcggctc
agggcggccacccgggttccggacactacgctggtgaagcggcctgtggagccccaggct
ggggccgagcctagcacagaagccccaaggtggcccctgcctgtgaagaggctgagcttg
ccctccaccaagccacagctttctgaggaacaggctgctgtgctgagggccgtcctgaaa
ggccagagcatcttcttcactgggagtgcaggaacagggaagtcatatctgctaaagcga
atcctgggctcactgccccccacaggcactgtggccactgccagcactggggtggcagcc
tgccacatcgggggcaccaccctccatgcctttgcaggcatcggctcaggccaggctcct
ctagcccagtgtgtggccctggcccaaaggccaggcgtgcggcagggctggctgaactgc
cagcggttggtcattgacgagatctcaatggtggaggcagacctgtttgacaaactggag
gccgtggccagagctgtccggcagcagaacaagccattcggagggatccagctcatcatc
tgtggggactttctgcagctgccacctgtgaccaagggctcccagcccccacggttctgc
ttccagtccaagagctggaagaggtgtgtgccagtgaccctggagctgaccaaggtgtgg
aggcaggcagaccagaccttcatctctctactgcaggccgtgaggctaggcaggtgttca
gatgaggtgacccgccagctccaggccacagcttcccacaaggtggggcgagatgggatt
gtggccacgaggctctgcacccaccaggatgatgtggccctcaccaacgagaggcggctt
caggagctgccaggtaaggtacacagatttgaggctatggacagcaaccctgagctggcc
agtaccctggatgcccagtgtcctgttagccagctccttcaactaaagctgggggcccag
gtgatgctggtgaaaaacttatcggtgtctcggggcctggtgaatggtgcccgaggggtg
gtagttgggttcgaggcagaagggagagggctaccccaggtgcggttcctgtgtggagtc
actgaggtcatccacgctgaccgctggacggtgcaggccaccgggggccagctcctcagt
cggcagcagctgcccctccagctggcctgggcgatgtccatccacaagagccaaggcatg
accctggattgtgtggagatttctctgggccgtgtgtttgccagtggccaggcctatgtg
gccctttctcgggcccgcagcctgcagggcctacgtgtgctggactttgaccccatggcg
gttcgctgtgacccccgtgtgctgcacttctatgccaccctgcggcggggcaggagcctc
agtctggagtccccagatgatgatgaggcagcctcagaccaggagaacatggacccaatc
ctctga

DBGET integrated database retrieval system