KEGG   Homo sapiens (human): 81929
Entry
81929             CDS       T01001                                 
Symbol
SEH1L, SEC13L, SEH1A, SEH1B, Seh1
Name
(RefSeq) SEH1 like nucleoporin
  KO
K14299  nucleoporin SEH1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa04150  mTOR signaling pathway
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    81929 (SEH1L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    81929 (SEH1L)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    81929 (SEH1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    81929 (SEH1L)
   04131 Membrane trafficking [BR:hsa04131]
    81929 (SEH1L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     81929 (SEH1L)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   SEACAT/GATOR2 complex
    81929 (SEH1L)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 81929
NCBI-ProteinID: NP_112493
OMIM: 609263
HGNC: 30379
Ensembl: ENSG00000085415
Vega: OTTHUMG00000181909
Pharos: Q96EE3(Tbio)
UniProt: Q96EE3
Structure
LinkDB
Position
18:12948011..12987536
AA seq 360 aa
MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSV
WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVK
FAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSP
MIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAI
ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDG
CVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtttgtggctcgcagcatcgcggcggaccacaaggatctcatccacgatgtctctttc
gacttccacgggcggcggatggcaacctgctccagcgatcagagcgttaaggtctgggat
aaaagtgaaagtggtgattggcattgtactgctagctggaagacacatagtggatctgta
tggcgtgtgacatgggcccatcctgaatttgggcaggttttggcttcctgttcttttgac
cgaacagctgctgtatgggaagaaatagtaggagaatcaaatgataaactgcgaggacag
agccactgggttaaaaggacaactctggtggatagcagaacatctgttactgatgtgaag
tttgctcccaagcacatgggtcttatgttagcaacctgttccgcagatggtatagtaaga
atctatgaggcaccagatgttatgaatctcagccagtggtctttgcagcatgagatctca
tgtaagctaagctgtagttgtatttcttggaacccttcaagctctcgtgctcattccccc
atgatcgccgtaggaagtgatgacagtagccccaacgcaatggccaaggttcagattttt
gaatataatgaaaacaccaggaaatatgcaaaagctgaaactcttatgacagtcactgat
cctgttcatgatattgcattcgctccaaatttgggaagatctttccatattctagcaata
gcgaccaaagatgtgagaatttttacattaaagcctgtgaggaaagaactgacttcctct
ggtgggccaacaaagtttgaaatccatatagtggctcagttcgataatcataattctcag
gtctggcgagtgagttggaatataacaggaacggtgctagcatcttcaggagatgatggg
tgtgtaagattgtggaaagctaattatatggacaattggaagtgtactggtattttgaaa
ggtaatgggagcccagtcaatgggagttctcagcagggaacctcaaatccttccctaggt
tcaactattccaagtcttcagaattcattaaatggatcttctgctggcagaaagcacagc
tga

DBGET integrated database retrieval system